Products

cDNA Clones (14)
Proteins (7)
Antibodies (3)
Jump to Filters
View as table Download
KCNH7 (NM_033272) Human Tagged ORF Clone
RC215271

USD 1,010.00

In Stock

KCNH7 (Myc-DDK-tagged)-Human potassium voltage-gated channel, subfamily H (eag-related), member 7 (KCNH7), transcript variant 1

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
KCNH7 (NM_173162) Human Tagged ORF Clone
RC207714

USD 610.00

In Stock

KCNH7 (Myc-DDK-tagged)-Human potassium voltage-gated channel, subfamily H (eag-related), member 7 (KCNH7), transcript variant 2

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
KCNH7 (NM_173162) Human Tagged ORF Clone
RC207714L3

USD 810.00

3 Weeks

Lenti-ORF clone of KCNH7 (Myc-DDK-tagged)-Human potassium voltage-gated channel, subfamily H (eag-related), member 7 (KCNH7), transcript variant 2

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
KCNH7 (NM_173162) Human Tagged ORF Clone Lentiviral Particle
RC207714L3V

USD 1,010.00

6 Weeks

Lenti ORF particles, KCNH7 (Myc-DDK-tagged)-Human potassium voltage-gated channel, subfamily H (eag-related), member 7 (KCNH7), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
KCNH7 (NM_173162) Human Tagged ORF Clone
RC207714L4

USD 810.00

3 Weeks

Lenti-ORF clone of KCNH7 (mGFP-tagged)-Human potassium voltage-gated channel, subfamily H (eag-related), member 7 (KCNH7), transcript variant 2

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
KCNH7 (NM_173162) Human Tagged ORF Clone Lentiviral Particle
RC207714L4V

USD 1,010.00

6 Weeks

Lenti ORF particles, KCNH7 (mGFP-tagged)-Human potassium voltage-gated channel, subfamily H (eag-related), member 7 (KCNH7), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
KCNH7 (NM_033272) Human Tagged ORF Clone
RC215271L3

USD 1,210.00

3 Weeks

Lenti ORF clone of Human potassium voltage-gated channel, subfamily H (eag-related), member 7 (KCNH7), transcript variant 1, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
KCNH7 (NM_033272) Human Tagged ORF Clone Lentiviral Particle
RC215271L3V

USD 1,410.00

6 Weeks

Lenti ORF particles, KCNH7 (Myc-DDK tagged) - Human potassium voltage-gated channel, subfamily H (eag-related), member 7 (KCNH7), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
KCNH7 (NM_033272) Human Tagged ORF Clone
RC215271L4

USD 1,210.00

3 Weeks

Lenti ORF clone of Human potassium voltage-gated channel, subfamily H (eag-related), member 7 (KCNH7), transcript variant 1, mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
KCNH7 (NM_033272) Human Tagged ORF Clone Lentiviral Particle
RC215271L4V

USD 1,410.00

6 Weeks

Lenti ORF particles, KCNH7 (mGFP-tagged) - Human potassium voltage-gated channel, subfamily H (eag-related), member 7 (KCNH7), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
KCNH7 (NM_173162) Human Tagged ORF Clone
RG207714

USD 670.00

3 Weeks

KCNH7 (GFP-tagged) - Human potassium voltage-gated channel, subfamily H (eag-related), member 7 (KCNH7), transcript variant 2

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
KCNH7 (NM_033272) Human Tagged ORF Clone
RG215271

USD 1,110.00

3 Weeks

KCNH7 (GFP-tagged) - Human potassium voltage-gated channel, subfamily H (eag-related), member 7 (KCNH7), transcript variant 1

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
KCNH7 (N-term) Rabbit Polyclonal Antibody
AP52306PU-N

USD 450.00

2 Weeks

KCNH7 (N-term) rabbit polyclonal antibody, Aff - Purified

Applications FC, IHC, WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide between 58~87 amino acids from the N-terminal region of human KCNH7
KCNH7 (NM_173162) Human Untagged Clone
SC122143

USD 760.00

In Stock

KCNH7 (untagged)-Human potassium voltage-gated channel, subfamily H (eag-related), member 7 (KCNH7), transcript variant 2

Vector pCMV6-XL4
Tag Tag Free
Mammalian Cell Selection None
KCNH7 CytoSection
TS415271P5

USD 978.00

In Stock

Transient overexpression of KCNH7 (NM_033272) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack

KCNH7 (NM_033272) Human Untagged Clone
SC315257

USD 2,420.00

2 Weeks

KCNH7 (untagged)-Human potassium voltage-gated channel, subfamily H (eag-related), member 7 (KCNH7), transcript variant 1

Vector pCMV6-XL4
Tag Tag Free
Mammalian Cell Selection None
KCNH7 Rabbit Polyclonal Antibody
TA338722

USD 375.00

5 Days

Rabbit Polyclonal Anti-KCNH7 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-KCNH7 antibody: synthetic peptide directed towards the middle region of human KCNH7. Synthetic peptide located within the following region: LEKSKLKSKESLSSGVHLNTASEDNLTSLLKQDSDLSLELHLRQRKTYVH
KCNH7 Rabbit Polyclonal Antibody
TA338765

USD 375.00

5 Days

Rabbit Polyclonal Anti-KCNH7 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-KCNH7 antibody: synthetic peptide directed towards the N terminal of human KCNH7. Synthetic peptide located within the following region: PILPIKTVNRKFFGFKFPGLRVLTYRKQSLPQEDPDVVVIDSSKHSDDSV
KCNH7 (NM_033272) Human Over-expression Lysate
LC409640

USD 187.00

2 Weeks

KCNH7 HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
KCNH7 (NM_033272) Human Over-expression Lysate
LY409640

USD 605.00

5 Days

Transient overexpression lysate of potassium voltage-gated channel, subfamily H (eag-related), member 7 (KCNH7), transcript variant 1

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
KCNH7 (NM_173162) ICC Control Block
TB407714

USD 1,260.00

4 Weeks

Transient overexpression of KCNH7 (NM_173162) in HEK293T cells paraffin embedded controls for ICC/IHC staining

KCNH7 Cytosection
TS407714

USD 225.00

4 Weeks

Transient overexpression of KCNH7 (NM_173162) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack

KCNH7 Cytosection
TS407714P5

USD 889.00

4 Weeks

Transient overexpression of KCNH7 (NM_173162) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack

KCNH7 Cytosection
TS415271

USD 225.00

4 Weeks

Transient overexpression of KCNH7 (NM_033272) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack