Products

cDNA Clones (12)
Proteins (5)
Antibodies (2)
Jump to Filters
View as table Download
LETM1 (NM_012318) Human Tagged ORF Clone
RC202855

USD 610.00

In Stock

LETM1 (Myc-DDK-tagged)-Human leucine zipper-EF-hand containing transmembrane protein 1 (LETM1), nuclear gene encoding mitochondrial protein

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
LETM1 (NM_012318) Human Tagged ORF Clone Lentiviral Particle
RC202855L1V

USD 1,010.00

3 Weeks

Lenti ORF particles, LETM1 (Myc-DDK tagged) - Human leucine zipper-EF-hand containing transmembrane protein 1 (LETM1), nuclear gene encoding mitochondrial protein, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
  • LentiORF®
LETM1 (NM_012318) Human Tagged ORF Clone Lentiviral Particle
RC202855L2V

USD 1,010.00

6 Weeks

Lenti ORF particles, LETM1 (mGFP-tagged) - Human leucine zipper-EF-hand containing transmembrane protein 1 (LETM1), nuclear gene encoding mitochondrial protein, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP
Tag mGFP
  • LentiORF®
LETM1 (NM_012318) Human Tagged ORF Clone
RG202855

USD 670.00

In Stock

LETM1 (GFP-tagged) - Human leucine zipper-EF-hand containing transmembrane protein 1 (LETM1), nuclear gene encoding mitochondrial protein

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
LETM1 (NM_012318) Human Tagged ORF Clone
RC202855L3

USD 810.00

3 Weeks

Lenti ORF clone of Human leucine zipper-EF-hand containing transmembrane protein 1 (LETM1), nuclear gene encoding mitochondrial protein, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
LETM1 (NM_012318) Human Tagged ORF Clone Lentiviral Particle
RC202855L3V

USD 1,010.00

5 Weeks

Lenti ORF particles, LETM1 (Myc-DDK tagged) - Human leucine zipper-EF-hand containing transmembrane protein 1 (LETM1), nuclear gene encoding mitochondrial protein, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
LETM1 (NM_012318) Human Tagged ORF Clone Lentiviral Particle
RC202855L4V

USD 1,010.00

3 Weeks

Lenti ORF particles, LETM1 (mGFP-tagged) - Human leucine zipper-EF-hand containing transmembrane protein 1 (LETM1), nuclear gene encoding mitochondrial protein, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
LETM1 (NM_012318) Human Untagged Clone
SC115448

USD 310.00

In Stock

LETM1 (untagged)-Human leucine zipper-EF-hand containing transmembrane protein 1 (LETM1), nuclear gene encoding mitochondrial protein

Vector pCMV6-XL4
Tag Tag Free
Mammalian Cell Selection None
LETM1 (NM_012318) Human Tagged ORF Clone
RC202855L1

USD 1,008.00

In Stock

Lenti ORF clone of Human leucine zipper-EF-hand containing transmembrane protein 1 (LETM1), nuclear gene encoding mitochondrial protein, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
Mammalian Cell Selection None
  • LentiORF®
LETM1 (NM_012318) Human Tagged ORF Clone
RC202855L4

USD 1,008.00

In Stock

Lenti ORF clone of Human leucine zipper-EF-hand containing transmembrane protein 1 (LETM1), nuclear gene encoding mitochondrial protein, mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
LETM1 Rabbit Polyclonal Antibody
TA308234

USD 415.00

2 Weeks

Rabbit Polyclonal antibody to LETM1 (leucine zipper-EF-hand containing transmembrane protein 1)

Applications IF, IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Recombinant fragment contain a sequence corresponding to a region within amino acids 506 and 723 of LETM1 (Uniprot ID#O95202)
LETM1 (NM_012318) Human Tagged ORF Clone
RC202855L2

USD 810.00

3 Weeks

Lenti ORF clone of Human leucine zipper-EF-hand containing transmembrane protein 1 (LETM1), nuclear gene encoding mitochondrial protein, mGFP tagged

Vector pLenti-C-mGFP
Tag mGFP
Mammalian Cell Selection None
  • LentiORF®
LETM1 (NM_012318) Human Untagged Clone
SC320328

USD 310.00

In Stock

LETM1 (untagged)-Human leucine zipper-EF-hand containing transmembrane protein 1 (LETM1), nuclear gene encoding mitochondrial protein

Vector pCMV6-AC
Tag Tag Free
Mammalian Cell Selection Neomycin
LETM1 (NM_012318) Human Over-expression Lysate
LC402195

USD 121.00

In Stock

LETM1 HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
LETM1 (NM_012318) Human Over-expression Lysate
LY402195

USD 396.00

5 Days

Transient overexpression lysate of leucine zipper-EF-hand containing transmembrane protein 1 (LETM1), nuclear gene encoding mitochondrial protein

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
LETM1 Rabbit Polyclonal Antibody
TA341905

USD 310.00

5 Days

Rabbit Polyclonal Anti-LETM1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-LETM1 antibody: synthetic peptide directed towards the middle region of human LETM1. Synthetic peptide located within the following region: MALKNKAAKGSATKDFSVFFQKIRETGERPSNEEIMRFSKLFEDELTLDN
LETM1 ICC Control Block
TB402855

USD 1,260.00

4 Weeks

Transient overexpression of LETM1 (NM_012318) in HEK293T cells paraffin embedded controls for ICC/IHC staining

LETM1 Cytosection
TS402855

USD 225.00

4 Weeks

Transient overexpression of LETM1 (NM_012318) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack

LETM1 Cytosection
TS402855P5

USD 889.00

4 Weeks

Transient overexpression of LETM1 (NM_012318) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack