Products

View as table Download

PSEN1 (untagged)-Human presenilin 1 (PSEN1), transcript variant 1

Vector pCMV6-XL5
Tag Tag Free
Mammalian Cell Selection None

PSEN1 (GFP-tagged) - Human presenilin 1 (PSEN1), transcript variant 1

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®

PSEN1 (Myc-DDK-tagged)-Human presenilin 1 (PSEN1), transcript variant 2

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®

Lenti-ORF clone of PSEN1 (Myc-DDK-tagged)-Human presenilin 1 (PSEN1), transcript variant 2

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti-ORF clone of PSEN1 (mGFP-tagged)-Human presenilin 1 (PSEN1), transcript variant 2

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

PSEN1 (GFP-tagged) - Human presenilin 1 (PSEN1), transcript variant 2

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®

Rabbit Polyclonal Presenilin1 Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Presenilin1 antibody was raised against a 23 amino acid peptide from near the carboxy terminus of human presenilin1.

Lenti ORF clone of Human presenilin 1 (PSEN1), transcript variant 1, mGFP tagged

Vector pLenti-C-mGFP
Tag mGFP
Mammalian Cell Selection None
  • LentiORF®

Rabbit polyclonal Presenilin 1 antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from human presenilin 1.

Rabbit Polyclonal Anti-Presenilin 1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-Presenilin 1 Antibody: A synthesized peptide derived from human Presenilin 1

PSEN1 HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB

Rabbit Polyclonal Anti-PSEN1 Antibody

Applications WB
Reactivities Human, Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-PSEN1 antibody: synthetic peptide directed towards the N terminal of human PSEN1. Synthetic peptide located within the following region: TRKDGQLIYTPFTEDTETVGQRALHSILNAAIMISVIVVMTILLVVLYKY

Rabbit Polyclonal Presenilin-1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptides corresponding to the N terminal sequence MVELMFP and the C terminal sequence LLGLPID of the human Presenilin 1 protein.

Rabbit anti Presenillin Polyclonal Antibody

Reactivities Human
Conjugation Unconjugated

PSEN1 MS Standard C13 and N15-labeled recombinant protein (NP_000012)

Tag C-Myc/DDK
Expression Host HEK293

PSEN1 Antibody - middle region

Applications IHC, IP, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the middle region of human PSEN1

Transient overexpression of PSEN1 (NM_000021) in HEK293T cells paraffin embedded controls for ICC/IHC staining

Transient overexpression of PSEN1 (NM_007318) in HEK293T cells paraffin embedded controls for ICC/IHC staining

Transient overexpression of PSEN1 (NM_000021) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack

Transient overexpression of PSEN1 (NM_000021) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack

Transient overexpression of PSEN1 (NM_007318) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack

Transient overexpression of PSEN1 (NM_007318) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack