Germany
Japan
United Kingdom
China
PTGIS (Myc-DDK-tagged)-Human prostaglandin I2 (prostacyclin) synthase (PTGIS)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
Products
View as table Download
Lenti ORF particles, PTGIS (Myc-DDK tagged) - Human prostaglandin I2 (prostacyclin) synthase (PTGIS), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
- LentiORF®
-
Lenti ORF particles, PTGIS (mGFP-tagged) - Human prostaglandin I2 (prostacyclin) synthase (PTGIS), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
- LentiORF®
-
PTGIS (GFP-tagged) - Human prostaglandin I2 (prostacyclin) synthase (PTGIS)
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti ORF clone of Human prostaglandin I2 (prostacyclin) synthase (PTGIS), Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, PTGIS (Myc-DDK tagged) - Human prostaglandin I2 (prostacyclin) synthase (PTGIS), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Human prostaglandin I2 (prostacyclin) synthase (PTGIS), mGFP tagged
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, PTGIS (mGFP-tagged) - Human prostaglandin I2 (prostacyclin) synthase (PTGIS), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Transient overexpression lysate of prostaglandin I2 (prostacyclin) synthase (PTGIS)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Lenti ORF clone of Human prostaglandin I2 (prostacyclin) synthase (PTGIS), Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
| Mammalian Cell Selection | None |
- LentiORF®
Rabbit polyclonal anti-PTGIS antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from Internal of human PTGIS. |
Lenti ORF clone of Human prostaglandin I2 (prostacyclin) synthase (PTGIS), mGFP tagged
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
| Mammalian Cell Selection | None |
- LentiORF®
PTGIS (untagged)-Human prostaglandin I2 (prostacyclin) synthase (PTGIS)
| Vector | pCMV6-XL4 |
| Tag | Tag Free |
| Mammalian Cell Selection | None |
PTGIS HEK293T cell transient overexpression lysate (as WB positive control)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
Rabbit Polyclonal Anti-PTGIS Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PTGIS antibody: synthetic peptide directed towards the middle region of human PTGIS. Synthetic peptide located within the following region: EIYTDPEVFKYNRFLNPDGSEKKDFYKDGKRLKNYNMPWGAGHNHCLGRS |
PTGIS MS Standard C13 and N15-labeled recombinant protein (NP_000952)
| Tag | C-Myc/DDK |
| Expression Host | HEK293 |
Transient overexpression of PTGIS (NM_000961) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of PTGIS (NM_000961) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of PTGIS (NM_000961) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack
Active filters
Target Symbol
- PTGIS
Families
- Transmembrane