TMEM9 (Myc-DDK-tagged)-Human transmembrane protein 9 (TMEM9)
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
TMEM9 (Myc-DDK-tagged)-Human transmembrane protein 9 (TMEM9)
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
TMEM9 (myc-DDK-tagged) - Human transmembrane protein 9 (TMEM9), transcript variant 2
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
TMEM9 (myc-DDK-tagged) - Human transmembrane protein 9 (TMEM9), transcript variant 3
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
TMEM9 (myc-DDK-tagged) - Human transmembrane protein 9 (TMEM9), transcript variant 4
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
TMEM9 (myc-DDK-tagged) - Human transmembrane protein 9 (TMEM9), transcript variant 5
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
TMEM9 (myc-DDK-tagged) - Human transmembrane protein 9 (TMEM9), transcript variant 6
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
TMEM9 (myc-DDK-tagged) - Human transmembrane protein 9 (TMEM9), transcript variant 7
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
TMEM9 (GFP-tagged) - Human transmembrane protein 9 (TMEM9)
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
Lenti ORF clone of Human transmembrane protein 9 (TMEM9), Myc-DDK-tagged
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, TMEM9 (Myc-DDK tagged) - Human transmembrane protein 9 (TMEM9), 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF clone of Human transmembrane protein 9 (TMEM9), mGFP tagged
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, TMEM9 (mGFP-tagged) - Human transmembrane protein 9 (TMEM9), 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
TMEM9 (myc-DDK-tagged) - Human transmembrane protein 9 (TMEM9), transcript variant 8
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
TMEM9 (myc-DDK-tagged) - Human transmembrane protein 9 (TMEM9), transcript variant 9
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
TMEM9 (untagged)-Human transmembrane protein 9 (TMEM9)
Vector | pCMV6-XL5 |
Tag | Tag Free |
Mammalian Cell Selection | None |
Transient overexpression lysate of transmembrane protein 9 (TMEM9)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
(untagged)-Human cDNA FLJ37269 fis, clone BRAMY2011679
Vector | pCMV6-XL5 |
Tag | Tag Free |
Mammalian Cell Selection | None |
Purified recombinant protein of Human transmembrane protein 9 (TMEM9), full length, with N-terminal GST and C-terminal His tag, expressed in E. coli, 50ug
Tag | N-GST and C-His |
Expression Host | E. coli |
Rabbit Polyclonal Anti-TMEM9 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-TMEM9 antibody: synthetic peptide directed towards the C terminal of human TMEM9. Synthetic peptide located within the following region: DARSMAAAAASLGGPRANTVLERVEGAQQRWKLQVQEQRKTVFDRHKMLS |
TMEM9 HEK293T cell transient overexpression lysate (as WB positive control)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
TMEM9 (GFP-tagged) - Human transmembrane protein 9 (TMEM9), transcript variant 2
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
TMEM9 (GFP-tagged) - Human transmembrane protein 9 (TMEM9), transcript variant 3
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
TMEM9 (GFP-tagged) - Human transmembrane protein 9 (TMEM9), transcript variant 4
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
TMEM9 (GFP-tagged) - Human transmembrane protein 9 (TMEM9), transcript variant 5
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
TMEM9 (GFP-tagged) - Human transmembrane protein 9 (TMEM9), transcript variant 6
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
TMEM9 (GFP-tagged) - Human transmembrane protein 9 (TMEM9), transcript variant 7
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
TMEM9 (GFP-tagged) - Human transmembrane protein 9 (TMEM9), transcript variant 8
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
TMEM9 (GFP-tagged) - Human transmembrane protein 9 (TMEM9), transcript variant 9
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
TMEM9 (untagged) - Human transmembrane protein 9 (TMEM9), transcript variant 2
Vector | pCMV6-Entry |
Tag | Tag Free |
TMEM9 (untagged) - Human transmembrane protein 9 (TMEM9), transcript variant 3
Vector | pCMV6-Entry |
Tag | Tag Free |
TMEM9 (untagged) - Human transmembrane protein 9 (TMEM9), transcript variant 4
Vector | pCMV6-Entry |
Tag | Tag Free |
TMEM9 (untagged) - Human transmembrane protein 9 (TMEM9), transcript variant 5
Vector | pCMV6-Entry |
Tag | Tag Free |
TMEM9 (untagged) - Human transmembrane protein 9 (TMEM9), transcript variant 6
Vector | pCMV6-Entry |
Tag | Tag Free |
TMEM9 (untagged) - Human transmembrane protein 9 (TMEM9), transcript variant 7
Vector | pCMV6-Entry |
Tag | Tag Free |
TMEM9 (untagged) - Human transmembrane protein 9 (TMEM9), transcript variant 8
Vector | pCMV6-Entry |
Tag | Tag Free |
Mammalian Cell Selection | Neomycin |
TMEM9 (untagged) - Human transmembrane protein 9 (TMEM9), transcript variant 9
Vector | pCMV6-Entry |
Tag | Tag Free |
Mammalian Cell Selection | Neomycin |
Transient overexpression of TMEM9 (NM_016456) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of TMEM9 (NM_001288564) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of TMEM9 (NM_001288565) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of TMEM9 (NM_001288566) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of TMEM9 (NM_001288567) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of TMEM9 (NM_001288568) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of TMEM9 (NM_001288569) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of TMEM9 (NM_001288570) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of TMEM9 (NM_001288571) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of TMEM9 (NM_016456) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of TMEM9 (NM_016456) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack
Transient overexpression of TMEM9 (NM_001288564) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of TMEM9 (NM_001288564) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack
Transient overexpression of TMEM9 (NM_001288565) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack