Products

View as table Download

USD 98.00

USD 390.00

In Stock

TMEM9 (Myc-DDK-tagged)-Human transmembrane protein 9 (TMEM9)

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin

TMEM9 (myc-DDK-tagged) - Human transmembrane protein 9 (TMEM9), transcript variant 2

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®

TMEM9 (myc-DDK-tagged) - Human transmembrane protein 9 (TMEM9), transcript variant 3

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®

TMEM9 (myc-DDK-tagged) - Human transmembrane protein 9 (TMEM9), transcript variant 4

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®

TMEM9 (myc-DDK-tagged) - Human transmembrane protein 9 (TMEM9), transcript variant 5

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®

TMEM9 (myc-DDK-tagged) - Human transmembrane protein 9 (TMEM9), transcript variant 6

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®

TMEM9 (myc-DDK-tagged) - Human transmembrane protein 9 (TMEM9), transcript variant 7

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®

TMEM9 (GFP-tagged) - Human transmembrane protein 9 (TMEM9)

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®

Lenti ORF clone of Human transmembrane protein 9 (TMEM9), Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF clone of Human transmembrane protein 9 (TMEM9), mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF particles, TMEM9 (mGFP-tagged) - Human transmembrane protein 9 (TMEM9), 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

TMEM9 (myc-DDK-tagged) - Human transmembrane protein 9 (TMEM9), transcript variant 8

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®

TMEM9 (myc-DDK-tagged) - Human transmembrane protein 9 (TMEM9), transcript variant 9

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®

TMEM9 (untagged)-Human transmembrane protein 9 (TMEM9)

Vector pCMV6-XL5
Tag Tag Free
Mammalian Cell Selection None

Transient overexpression lysate of transmembrane protein 9 (TMEM9)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB

(untagged)-Human cDNA FLJ37269 fis, clone BRAMY2011679

Vector pCMV6-XL5
Tag Tag Free
Mammalian Cell Selection None

Purified recombinant protein of Human transmembrane protein 9 (TMEM9), full length, with N-terminal GST and C-terminal His tag, expressed in E. coli, 50ug

Tag N-GST and C-His
Expression Host E. coli

Rabbit Polyclonal Anti-TMEM9 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-TMEM9 antibody: synthetic peptide directed towards the C terminal of human TMEM9. Synthetic peptide located within the following region: DARSMAAAAASLGGPRANTVLERVEGAQQRWKLQVQEQRKTVFDRHKMLS

TMEM9 HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB

TMEM9 (GFP-tagged) - Human transmembrane protein 9 (TMEM9), transcript variant 2

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®

TMEM9 (GFP-tagged) - Human transmembrane protein 9 (TMEM9), transcript variant 3

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®

TMEM9 (GFP-tagged) - Human transmembrane protein 9 (TMEM9), transcript variant 4

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®

TMEM9 (GFP-tagged) - Human transmembrane protein 9 (TMEM9), transcript variant 5

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®

TMEM9 (GFP-tagged) - Human transmembrane protein 9 (TMEM9), transcript variant 6

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®

TMEM9 (GFP-tagged) - Human transmembrane protein 9 (TMEM9), transcript variant 7

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®

TMEM9 (GFP-tagged) - Human transmembrane protein 9 (TMEM9), transcript variant 8

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®

TMEM9 (GFP-tagged) - Human transmembrane protein 9 (TMEM9), transcript variant 9

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®

TMEM9 (untagged) - Human transmembrane protein 9 (TMEM9), transcript variant 2

Vector pCMV6-Entry
Tag Tag Free

TMEM9 (untagged) - Human transmembrane protein 9 (TMEM9), transcript variant 3

Vector pCMV6-Entry
Tag Tag Free

TMEM9 (untagged) - Human transmembrane protein 9 (TMEM9), transcript variant 4

Vector pCMV6-Entry
Tag Tag Free

TMEM9 (untagged) - Human transmembrane protein 9 (TMEM9), transcript variant 5

Vector pCMV6-Entry
Tag Tag Free

TMEM9 (untagged) - Human transmembrane protein 9 (TMEM9), transcript variant 6

Vector pCMV6-Entry
Tag Tag Free

TMEM9 (untagged) - Human transmembrane protein 9 (TMEM9), transcript variant 7

Vector pCMV6-Entry
Tag Tag Free

TMEM9 (untagged) - Human transmembrane protein 9 (TMEM9), transcript variant 8

Vector pCMV6-Entry
Tag Tag Free
Mammalian Cell Selection Neomycin

TMEM9 (untagged) - Human transmembrane protein 9 (TMEM9), transcript variant 9

Vector pCMV6-Entry
Tag Tag Free
Mammalian Cell Selection Neomycin

Transient overexpression of TMEM9 (NM_016456) in HEK293T cells paraffin embedded controls for ICC/IHC staining

Transient overexpression of TMEM9 (NM_001288564) in HEK293T cells paraffin embedded controls for ICC/IHC staining

Transient overexpression of TMEM9 (NM_001288565) in HEK293T cells paraffin embedded controls for ICC/IHC staining

Transient overexpression of TMEM9 (NM_001288566) in HEK293T cells paraffin embedded controls for ICC/IHC staining

Transient overexpression of TMEM9 (NM_001288567) in HEK293T cells paraffin embedded controls for ICC/IHC staining

Transient overexpression of TMEM9 (NM_001288568) in HEK293T cells paraffin embedded controls for ICC/IHC staining

Transient overexpression of TMEM9 (NM_001288569) in HEK293T cells paraffin embedded controls for ICC/IHC staining

Transient overexpression of TMEM9 (NM_001288570) in HEK293T cells paraffin embedded controls for ICC/IHC staining

Transient overexpression of TMEM9 (NM_001288571) in HEK293T cells paraffin embedded controls for ICC/IHC staining

USD 225.00

4 Weeks

Transient overexpression of TMEM9 (NM_016456) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack

USD 889.00

4 Weeks

Transient overexpression of TMEM9 (NM_016456) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack

USD 225.00

4 Weeks

Transient overexpression of TMEM9 (NM_001288564) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack

USD 889.00

4 Weeks

Transient overexpression of TMEM9 (NM_001288564) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack

USD 225.00

4 Weeks

Transient overexpression of TMEM9 (NM_001288565) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack