Products

cDNA Clones (37)
Proteins (19)
Antibodies (6)
Jump to Filters
View as table Download
Thyroid Peroxidase (TPO) (NM_001206744) Human Tagged ORF Clone
RC235054

USD 750.00

In Stock

TPO (Myc-DDK tagged) - Homo sapiens thyroid peroxidase (TPO), transcript variant 6

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
Thyroid Peroxidase (TPO) (NM_000547) Human Tagged ORF Clone Lentiviral Particle
RC210659L3V

USD 1,150.00

7 Weeks

Lenti ORF particles, TPO (Myc-DDK tagged) - Human thyroid peroxidase (TPO), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Thyroid Peroxidase (TPO) (NM_175722) Human Tagged ORF Clone
RC220611

USD 850.00

4 Weeks

TPO (Myc-DDK-tagged)-Human thyroid peroxidase (TPO), transcript variant 5

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
Thyroid Peroxidase (TPO) (NM_175722) Human Tagged ORF Clone Lentiviral Particle
RC220611L3V

USD 1,250.00

7 Weeks

Lenti ORF particles, TPO (Myc-DDK-tagged)-Human thyroid peroxidase (TPO), transcript variant 5, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Thyroid Peroxidase (TPO) (NM_175719) Human Tagged ORF Clone
RC222449

USD 750.00

5 Weeks

TPO (Myc-DDK-tagged)-Human thyroid peroxidase (TPO), transcript variant 2

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
Thyroid Peroxidase (TPO) (NM_175719) Human Tagged ORF Clone Lentiviral Particle
RC222449L3V

USD 1,150.00

8 Weeks

Lenti ORF particles, TPO (Myc-DDK-tagged)-Human thyroid peroxidase (TPO), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Thyroid Peroxidase (TPO) (NM_175721) Human Tagged ORF Clone
RC222500

USD 990.00

5 Weeks

TPO (Myc-DDK-tagged)-Human thyroid peroxidase (TPO), transcript variant 4

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
Thyroid Peroxidase (TPO) (NM_175721) Human Tagged ORF Clone Lentiviral Particle
RC222500L3V

USD 1,390.00

8 Weeks

Lenti ORF particles, TPO (Myc-DDK-tagged)-Human thyroid peroxidase (TPO), transcript variant 4, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Thyroid Peroxidase (TPO) (NM_001206745) Human Tagged ORF Clone
RC234985

USD 750.00

5 Weeks

TPO (Myc-DDK tagged) - Homo sapiens thyroid peroxidase (TPO), transcript variant 7

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
Thyroid Peroxidase (TPO) (NM_000547) Human Tagged ORF Clone
RG210659

USD 830.00

3 Weeks

TPO (GFP-tagged) - Human thyroid peroxidase (TPO), transcript variant 1

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
Thyroid Peroxidase (TPO) (NM_175722) Human Tagged ORF Clone
RG220611

USD 940.00

5 Weeks

TPO (GFP-tagged) - Human thyroid peroxidase (TPO), transcript variant 5

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
Thyroid Peroxidase (TPO) (NM_175719) Human Tagged ORF Clone
RG222449

USD 830.00

5 Weeks

TPO (GFP-tagged) - Human thyroid peroxidase (TPO), transcript variant 2

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
Thyroid Peroxidase (TPO) (NM_175721) Human Tagged ORF Clone
RG222500

USD 1,090.00

5 Weeks

TPO (GFP-tagged) - Human thyroid peroxidase (TPO), transcript variant 4

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
Thyroid Peroxidase (TPO) (NM_001206745) Human Tagged ORF Clone
RG234985

USD 830.00

5 Weeks

TPO (GFP-tagged) - Homo sapiens thyroid peroxidase (TPO), transcript variant 7

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
Thyroid Peroxidase (TPO) (NM_001206744) Human Tagged ORF Clone
RG235054

USD 830.00

3 Weeks

TPO (GFP-tagged) - Homo sapiens thyroid peroxidase (TPO), transcript variant 6

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
Thyroid Peroxidase (TPO) (NM_000547) Human Untagged Clone
SC300094

USD 760.00

In Stock

TPO (untagged)-Human thyroid peroxidase (TPO), transcript variant 1

Vector PCMV6-Neo
Tag Tag Free
Mammalian Cell Selection Neomycin
Thyroid Peroxidase (TPO) (NM_000547) Human Over-expression Lysate
LY424648

USD 396.00

In Stock

Transient overexpression lysate of thyroid peroxidase (TPO), transcript variant 1

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
Thyroid Peroxidase (TPO) (NM_000547) Human Tagged ORF Clone
RC210659L2

USD 950.00

3 Weeks

Lenti ORF clone of Human thyroid peroxidase (TPO), transcript variant 1, mGFP tagged

Vector pLenti-C-mGFP
Tag mGFP
Mammalian Cell Selection None
  • LentiORF®
Thyroid Peroxidase (TPO) Mouse Monoclonal Antibody [Clone ID: TPO28]
4TP15-TPO28

USD 385.00

2 Weeks

Thyroid Peroxidase (TPO) mouse monoclonal antibody, clone TPO28

Applications ELISA, WB
Reactivities Human
Conjugation Unconjugated
Thyroid Peroxidase (TPO) Mouse Monoclonal Antibody [Clone ID: TPO34]
4TP15-TPO34

USD 385.00

2 Weeks

Thyroid Peroxidase (TPO) mouse monoclonal antibody, clone TPO34

Applications ELISA, WB
Reactivities Human
Conjugation Unconjugated
Thyroid Peroxidase (TPO) (NM_000547) Human Over-expression Lysate
LC424648

USD 121.00

In Stock

TPO HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
Thyroid Peroxidase (TPO) Goat Polyclonal Antibody
TA309510

USD 375.00

5 Days

Goat Polyclonal Antibody against thyroid peroxidase

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence C-TRHVIQVSNEVVTDD, from the internal region of the protein sequence according to NP_000538.3; NP_783650.1; NP_783652.1; NP_783653.1.
Thyroid Peroxidase (TPO) Mouse Monoclonal Antibody [Clone ID: TPO35]
4TP15-TPO35

USD 385.00

2 Weeks

Thyroid Peroxidase (TPO) mouse monoclonal antibody, clone TPO35

Applications ELISA
Reactivities Human
Conjugation Unconjugated
Thyroid Peroxidase (TPO) Rabbit Polyclonal Antibody
TA335246

USD 375.00

5 Days

Rabbit Polyclonal Anti-TPO Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-TPO antibody is: synthetic peptide directed towards the N-terminal region of Human TPO. Synthetic peptide located within the following region: GASNTALARWLPPVYEDGFSQPRGWNPGFLYNGFPLPPVREVTRHVIQVS
Thyroid Peroxidase (TPO) (NM_000547) Human Mass Spec Standard
PH310659

USD 2,055.00

3 Weeks

TPO MS Standard C13 and N15-labeled recombinant protein (NP_000538)

Tag C-Myc/DDK
Expression Host HEK293
Thyroid Peroxidase (TPO) Rabbit Polyclonal Antibody
TA323628

USD 345.00

In Stock

Anti-TPO Rabbit Polyclonal Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Full length fusion protein
Thyroid Peroxidase (TPO) ICC Control Block
TB410659

USD 1,400.00

4 Weeks

Transient overexpression of TPO (NM_000547) in HEK293T cells paraffin embedded controls for ICC/IHC staining

Thyroid Peroxidase (TPO) ICC Control Block
TB420611

USD 1,500.00

4 Weeks

Transient overexpression of TPO (NM_175722) in HEK293T cells paraffin embedded controls for ICC/IHC staining

Thyroid Peroxidase (TPO) ICC Control Block
TB422449

USD 1,400.00

4 Weeks

Transient overexpression of TPO (NM_175719) in HEK293T cells paraffin embedded controls for ICC/IHC staining