Products

View as table Download

Rabbit Polyclonal Anti-CMAS Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CMAS antibody: synthetic peptide directed towards the N terminal of human CMAS. Synthetic peptide located within the following region: GRGVEKPPHLAALILARGGSKGIPLKNIKHLAGVPLIGWVLRAALDSGAF

Rabbit polyclonal antibody to CMAS (cytidine monophosphate N-acetylneuraminic acid synthetase)

Applications IF, WB
Reactivities Human
Immunogen Recombinant fragment corresponding to a region within amino acids 69 and 414 of CMAS (Uniprot ID#Q8NFW8)