Products

View as table Download

Rabbit Polyclonal Anti-AK3 Antibody - N-terminal region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-AK3 antibody: synthetic peptide directed towards the N terminal of human AK3. Synthetic peptide located within the following region: MGASARLLRAVIMGAPGSGKGTVSSRITTHFELKHLSSGDLLRDNMLRGT

AK3 Rabbit polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-227 of human AK3 (NP_057366.2).
Modifications Unmodified