Products

Antibodies (38)
cDNA Clones (38)
Proteins (18)
RNAi (12)
Gene Expression (8)
Jump to Filters
View as table Download
AK3 (NM_016282) Human Tagged ORF Clone
RC204408

USD 98.00

USD 390.00

In Stock

AK3 (Myc-DDK-tagged)-Human adenylate kinase 3 (AK3), nuclear gene encoding mitochondrial protein, transcript variant 1

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
AK3 (NM_016282) Human Tagged ORF Clone Lentiviral Particle
RC204408L1V

USD 820.00

3 Weeks

Lenti ORF particles, AK3 (Myc-DDK tagged) - Human adenylate kinase 3 (AK3), nuclear gene encoding mitochondrial protein, transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
  • LentiORF®
AK3 (NM_016282) Human Tagged ORF Clone Lentiviral Particle
RC204408L2V

USD 820.00

6 Weeks

Lenti ORF particles, AK3 (mGFP-tagged) - Human adenylate kinase 3 (AK3), nuclear gene encoding mitochondrial protein, transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP
Tag mGFP
  • LentiORF®
Ak3 (NM_021299) Mouse Tagged ORF Clone
MR222489

USD 68.00

USD 219.00

In Stock

Ak3 (Myc-DDK-tagged) - Mouse adenylate kinase 3 (Ak3), nuclear gene encoding mitochondrial protein

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
AK3 (NM_016282) Human Tagged ORF Clone
RG204408

USD 460.00

In Stock

AK3 (GFP-tagged) - Human adenylate kinase 3 (AK3), nuclear gene encoding mitochondrial protein, transcript variant 1

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
AK3 Human Gene Knockout Kit (CRISPR)
KN404408

USD 1,290.00

2 Weeks

AK3 - KN2.0, Human gene knockout kit via CRISPR, non-homology mediated.

Format 2 gRNA vectors, 1 linear donor
Donor DNA EF1a-GFP-P2A-Puro
KN404408 is the updated version of KN204408.
Ak3 Mouse Gene Knockout Kit (CRISPR)
KN501056

USD 1,290.00

2 Weeks

Ak3 - KN2.0, Mouse gene knockout kit via CRISPR, non-homology mediated.

Format 2 gRNA vectors, 1 linear donor
Donor DNA EF1a-GFP-P2A-Puro
KN501056 is the updated version of KN301056.
Ak3 (NM_021299) Mouse Tagged ORF Clone
MG222489

USD 300.00

3 Weeks

Ak3 (GFP-tagged) - Mouse adenylate kinase 3 (Ak3) nuclear gene encoding mitochondrial protein, (10ug)

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
Ak3 (NM_021299) Mouse Tagged ORF Clone
MR222489L3

USD 500.00

3 Weeks

Lenti ORF clone of Ak3 (Myc-DDK-tagged) - Mouse adenylate kinase 3 (Ak3), nuclear gene encoding mitochondrial protein

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Ak3 (NM_021299) Mouse Tagged ORF Clone Lentiviral Particle
MR222489L3V

USD 700.00

6 Weeks

Lenti ORF particles, Ak3 (Myc-DDK-tagged) - Mouse adenylate kinase 3 (Ak3), nuclear gene encoding mitochondrial protein, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Ak3 (NM_021299) Mouse Tagged ORF Clone
MR222489L4

USD 500.00

3 Weeks

Lenti ORF clone of Ak3 (mGFP-tagged) - Mouse adenylate kinase 3 (Ak3), nuclear gene encoding mitochondrial protein

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
Ak3 (NM_021299) Mouse Tagged ORF Clone Lentiviral Particle
MR222489L4V

USD 700.00

6 Weeks

Lenti ORF particles, Ak3 (GFP-tagged) - Mouse adenylate kinase 3 (Ak3), nuclear gene encoding mitochondrial protein, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
AK3 (NM_016282) Human Tagged ORF Clone
RC204408L3

USD 620.00

3 Weeks

Lenti ORF clone of Human adenylate kinase 3 (AK3), nuclear gene encoding mitochondrial protein, transcript variant 1, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
AK3 (NM_016282) Human Tagged ORF Clone Lentiviral Particle
RC204408L3V

USD 820.00

5 Weeks

Lenti ORF particles, AK3 (Myc-DDK tagged) - Human adenylate kinase 3 (AK3), nuclear gene encoding mitochondrial protein, transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
AK3 (NM_016282) Human Tagged ORF Clone
RC204408L4

USD 620.00

3 Weeks

Lenti ORF clone of Human adenylate kinase 3 (AK3), nuclear gene encoding mitochondrial protein, transcript variant 1, mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
AK3 (NM_016282) Human Tagged ORF Clone Lentiviral Particle
RC204408L4V

USD 820.00

7 Weeks

Lenti ORF particles, AK3 (mGFP-tagged) - Human adenylate kinase 3 (AK3), nuclear gene encoding mitochondrial protein, transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
AK3 (NM_001199853) Human Tagged ORF Clone
RC231890

USD 420.00

3 Weeks

AK3 (Myc-DDK tagged) - Homo sapiens adenylate kinase 3 (AK3), transcript variant 3

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
AK3 (NM_001199855) Human Tagged ORF Clone
RC231891

USD 420.00

3 Weeks

AK3 (Myc-DDK tagged) - Homo sapiens adenylate kinase 3 (AK3), transcript variant 5

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
AK3 (NM_001199856) Human Tagged ORF Clone
RC231892

USD 420.00

3 Weeks

AK3 (Myc-DDK tagged) - Homo sapiens adenylate kinase 3 (AK3), transcript variant 6

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
AK3 (NM_001199852) Human Tagged ORF Clone
RC232029

USD 420.00

3 Weeks

AK3 (Myc-DDK tagged) - Homo sapiens adenylate kinase 3 (AK3), transcript variant 2

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
AK3 (NM_001199853) Human Tagged ORF Clone
RG231890

USD 460.00

3 Weeks

AK3 (GFP-tagged) - Homo sapiens adenylate kinase 3 (AK3), transcript variant 3

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
AK3 (NM_001199855) Human Tagged ORF Clone
RG231891

USD 460.00

3 Weeks

AK3 (GFP-tagged) - Homo sapiens adenylate kinase 3 (AK3), transcript variant 5

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
AK3 (NM_001199856) Human Tagged ORF Clone
RG231892

USD 460.00

3 Weeks

AK3 (GFP-tagged) - Homo sapiens adenylate kinase 3 (AK3), transcript variant 6

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
AK3 (NM_001199852) Human Tagged ORF Clone
RG232029

USD 460.00

3 Weeks

AK3 (GFP-tagged) - Homo sapiens adenylate kinase 3 (AK3), transcript variant 2

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
Ak3 (NM_013218) Rat Tagged ORF Clone
RR202076

USD 420.00

4 Weeks

Ak3 (Myc-DDK-tagged ORF) - Rat adenylate kinase 3 (Ak3), nuclear gene encoding mitochondrial protein, (10 ug)

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
Ak3 (NM_013218) Rat Tagged ORF Clone
RR202076L3

USD 640.00

8 Weeks

Lenti ORF clone of Ak3 (Myc-DDK-tagged ORF) - Rat adenylate kinase 3 (Ak3), nuclear gene encoding mitochondrial protein, (10 ug)

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Ak3 (NM_013218) Rat Tagged ORF Clone Lentiviral Particle
RR202076L3V

USD 850.00

12 Weeks

Lenti ORF particles, Ak3 (Myc-DDK-tagged ORF) - Rat adenylate kinase 3 (Ak3), nuclear gene encoding mitochondrial protein, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Ak3 (NM_013218) Rat Tagged ORF Clone
RR202076L4

USD 700.00

8 Weeks

Lenti ORF clone of Ak3 (mGFP-tagged ORF) - Rat adenylate kinase 3 (Ak3), nuclear gene encoding mitochondrial protein, (10 ug)

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
Ak3 (NM_013218) Rat Tagged ORF Clone Lentiviral Particle
RR202076L4V

USD 960.00

12 Weeks

Lenti ORF particles, Ak3 (GFP-tagged ORF) - Rat adenylate kinase 3 (Ak3), nuclear gene encoding mitochondrial protein, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
AK3 (NM_016282) Human Tagged ORF Clone
RC204408L1

USD 768.00

In Stock

Lenti ORF clone of Human adenylate kinase 3 (AK3), nuclear gene encoding mitochondrial protein, transcript variant 1, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
Mammalian Cell Selection None
  • LentiORF®
AK3 Rabbit Polyclonal Antibody
TA345043

USD 475.00

5 Days

Rabbit Polyclonal Anti-AK3 Antibody - N-terminal region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-AK3 antibody: synthetic peptide directed towards the N terminal of human AK3. Synthetic peptide located within the following region: MGASARLLRAVIMGAPGSGKGTVSSRITTHFELKHLSSGDLLRDNMLRGT
AK3 (NM_016282) Human Tagged ORF Clone
RC204408L2

USD 620.00

3 Weeks

Lenti ORF clone of Human adenylate kinase 3 (AK3), nuclear gene encoding mitochondrial protein, transcript variant 1, mGFP tagged

Vector pLenti-C-mGFP
Tag mGFP
Mammalian Cell Selection None
  • LentiORF®
AK3 (NM_016282) Human Over-expression Lysate
LC414079

USD 121.00

In Stock

AK3 HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
AK3 (NM_016282) Human Over-expression Lysate
LY414079

USD 396.00

5 Days

Transient overexpression lysate of adenylate kinase 3 (AK3), nuclear gene encoding mitochondrial protein

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
Ak3 (NM_021299) Mouse Untagged Clone
MC203306

USD 210.00

In Stock

Ak3 (untagged) - Mouse adenylate kinase 3 (Ak3), nuclear gene encoding mitochondrial protein, (10ug)

Vector PCMV6-Kan/Neo
Tag Tag Free
Mammalian Cell Selection Neomycin
AK3 (NM_016282) Human Untagged Clone
SC322473

USD 420.00

In Stock

AK3 (untagged)-Human adenylate kinase 3 (AK3), nuclear gene encoding mitochondrial protein, transcript variant 1

Vector pCMV6-AC
Tag Tag Free
Mammalian Cell Selection Neomycin
Adenylate kinase 3 / AK3 (1-223) Human Protein
AR09001PU-N

USD 1,105.00

2 Weeks

Adenylate kinase 3 / AK3 (1-223) human recombinant protein, 0.5 mg

Expression Host E. coli
Adenylate kinase 3 / AK3 (1-223) Human Protein
AR09001PU-S

USD 415.00

2 Weeks

Adenylate kinase 3 / AK3 (1-223) human recombinant protein, 0.1 mg

Expression Host E. coli
AK3 Mouse Monoclonal Antibody [Clone ID: OTI5A1]
CF501819

USD 465.00

4 Weeks

Carrier-free (BSA/glycerol-free) AK3 mouse monoclonal antibody, clone OTI5A1 (formerly 5A1)

Applications FC, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
AK3 Mouse Monoclonal Antibody [Clone ID: OTI6D6]
CF501833

USD 465.00

4 Weeks

Carrier-free (BSA/glycerol-free) AK3 mouse monoclonal antibody, clone OTI6D6 (formerly 6D6)

Applications WB
Reactivities Human, Monkey, Mouse, Rat, Dog
Conjugation Unconjugated
AK3 Mouse Monoclonal Antibody [Clone ID: OTI3G1]
CF501834

USD 465.00

4 Weeks

Carrier-free (BSA/glycerol-free) AK3 mouse monoclonal antibody, clone OTI3G1 (formerly 3G1)

Applications FC, IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
AK3 Mouse Monoclonal Antibody [Clone ID: OTI6B7]
CF501835

USD 465.00

4 Weeks

Carrier-free (BSA/glycerol-free) AK3 mouse monoclonal antibody, clone OTI6B7 (formerly 6B7)

Applications IHC, WB
Reactivities Human, Monkey, Mouse, Rat, Dog
Conjugation Unconjugated
AK3 Mouse Monoclonal Antibody [Clone ID: OTI4A2]
CF501862

USD 465.00

4 Weeks

Carrier-free (BSA/glycerol-free) AK3 mouse monoclonal antibody, clone OTI4A2 (formerly 4A2)

Applications FC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
AK3 Mouse Monoclonal Antibody [Clone ID: OTI6G4]
CF501863

USD 465.00

4 Weeks

Carrier-free (BSA/glycerol-free) AK3 mouse monoclonal antibody, clone OTI6G4 (formerly 6G4)

Applications FC, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
AK3 Mouse Monoclonal Antibody [Clone ID: OTI4C4]
CF501888

USD 465.00

4 Weeks

Carrier-free (BSA/glycerol-free) AK3 mouse monoclonal antibody, clone OTI4C4 (formerly 4C4)

Applications FC, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Human AK3 activation kit by CRISPRa
GA109451

USD 1,290.00

2 Weeks

AK3 CRISPRa kit - CRISPR gene activation of human adenylate kinase 3

Format 3gRNAs, 1 scramble ctrl and 1 enhancer vector
Mouse Ak3 activation kit by CRISPRa
GA205878

USD 1,290.00

2 Weeks

Ak3 CRISPRa kit - CRISPR gene activation of mouse adenylate kinase 3

Format 3gRNAs, 1 scramble ctrl and 1 enhancer vector
AK3 Human qPCR Template Standard (NM_016282)
HK210431

USD 440.00

5 Days

qPCR primer pairs and template standards against Homo sapiens gene AK3

Application Plasmid of exact quantity for transcript copy number calculation
AK3 Human qPCR Primer Pair (NM_016282)
HP212098

USD 120.00

5 Days

qSTAR qPCR primer pairs against Homo sapiens gene AK3