Products

View as table Download

Rabbit Polyclonal Anti-ASPN Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ASPN antibody: synthetic peptide directed towards the middle region of human ASPN. Synthetic peptide located within the following region: NKISTVELEDFKRYKELQRLGLGNNKITDIENGSLANIPRVREIHLENNK

Rabbit polyclonal ASPN Antibody (Center)

Applications IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen This ASPN antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 242-269 amino acids from the Central region of human ASPN.

Goat Polyclonal Antibody against ASPN

Applications IF, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Peptide with sequence C-IHENKVKKIQKDT, from the internal region of the protein sequence according to NP_060150.3.

Rabbit Polyclonal Anti-ASPN Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Synthetic peptide of human ASPN

ASPN Rabbit polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 100-379 of human ASPN (NP_060150.4).
Modifications Unmodified