Products

cDNA Clones (41)
RNAi (10)
Gene Expression (7)
Proteins (6)
Antibodies (5)
Jump to Filters
View as table Download
Asporin (ASPN) (NM_017680) Human Tagged ORF Clone
RC209353

USD 420.00

In Stock

ASPN (Myc-DDK-tagged)-Human asporin (ASPN), transcript variant 1

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
Aspn (NM_025711) Mouse Tagged ORF Clone
MR205760

USD 300.00

In Stock

Aspn (Myc-DDK-tagged) - Mouse asporin (Aspn), transcript variant 1

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
Aspn (NM_025711) Mouse Tagged ORF Clone Lentiviral Particle
MR205760L2V

USD 700.00

3 Weeks

Lenti ORF particles, Aspn (GFP-tagged) - Mouse asporin (Aspn), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP
Tag mGFP
  • LentiORF®
Aspn (NM_025711) Mouse Tagged ORF Clone Lentiviral Particle
MR205760L1V

USD 700.00

6 Weeks

Lenti ORF particles, Aspn (Myc-DDK-tagged) - Mouse asporin (Aspn), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
  • LentiORF®
Asporin (ASPN) (NM_017680) Human Tagged ORF Clone
RG209353

USD 460.00

In Stock

ASPN (GFP-tagged) - Human asporin (ASPN), transcript variant 1

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
Aspn (NM_025711) Mouse Tagged ORF Clone
MG205760

USD 330.00

2 Weeks

Aspn (GFP-tagged) - Mouse asporin (Aspn)

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
Aspn (NM_025711) Mouse Tagged ORF Clone Lentiviral Particle
MR205760L3V

USD 700.00

3 Weeks

Lenti ORF particles, Aspn (Myc-DDK-tagged) - Mouse asporin (Aspn), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Asporin (ASPN) Human Gene Knockout Kit (CRISPR)
KN409353

USD 1,290.00

2 Weeks

ASPN - KN2.0, Human gene knockout kit via CRISPR, non-homology mediated.

Format 2 gRNA vectors, 1 linear donor
Donor DNA EF1a-GFP-P2A-Puro
KN409353 is the updated version of KN209353.
Aspn Mouse Gene Knockout Kit (CRISPR)
KN501694

USD 1,290.00

2 Weeks

Aspn - KN2.0, Mouse gene knockout kit via CRISPR, non-homology mediated.

Format 2 gRNA vectors, 1 linear donor
Donor DNA EF1a-GFP-P2A-Puro
KN501694 is the updated version of KN301694.
Aspn (NM_001172481) Mouse Tagged ORF Clone
MG224923

USD 330.00

3 Weeks

Aspn (GFP-tagged) - Mouse asporin (Aspn) transcript variant 2, (10ug)

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
Aspn (NM_025711) Mouse Tagged ORF Clone
MR205760L4

USD 500.00

3 Weeks

Lenti ORF clone of Aspn (mGFP-tagged) - Mouse asporin (Aspn), transcript variant 1

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
Aspn (NM_025711) Mouse Tagged ORF Clone Lentiviral Particle
MR205760L4V

USD 700.00

6 Weeks

Lenti ORF particles, Aspn (GFP-tagged) - Mouse asporin (Aspn), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
Aspn (NM_001172481) Mouse Tagged ORF Clone
MR224923

USD 300.00

4 Weeks

Aspn (Myc-DDK-tagged) - Mouse asporin (Aspn), transcript variant 2

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
Aspn (NM_001172481) Mouse Tagged ORF Clone
MR224923L3

USD 500.00

3 Weeks

Lenti ORF clone of Aspn (Myc-DDK-tagged) - Mouse asporin (Aspn), transcript variant 2

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Aspn (NM_001172481) Mouse Tagged ORF Clone
MR224923L4

USD 500.00

3 Weeks

Lenti ORF clone of Aspn (mGFP-tagged) - Mouse asporin (Aspn), transcript variant 2

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
Asporin (ASPN) (NM_017680) Human Tagged ORF Clone
RC209353L3

USD 620.00

3 Weeks

Lenti ORF clone of Human asporin (ASPN), transcript variant 1, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Asporin (ASPN) (NM_017680) Human Tagged ORF Clone
RC209353L4

USD 620.00

3 Weeks

Lenti ORF clone of Human asporin (ASPN), transcript variant 1, mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
Asporin (ASPN) (NM_001193335) Human Tagged ORF Clone
RC231088

USD 420.00

3 Weeks

ASPN (Myc-DDK-tagged)-Human asporin (ASPN), transcript variant 2

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
Asporin (ASPN) (NM_001193335) Human Tagged ORF Clone
RC231088L3

USD 620.00

3 Weeks

Lenti-ORF clone of ASPN (Myc-DDK-tagged)-Human asporin (ASPN), transcript variant 2

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Asporin (ASPN) (NM_001193335) Human Tagged ORF Clone
RC231088L4

USD 620.00

3 Weeks

Lenti-ORF clone of ASPN (mGFP-tagged)-Human asporin (ASPN), transcript variant 2

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
Asporin (ASPN) (NM_001193335) Human Tagged ORF Clone
RG231088

USD 460.00

4 Weeks

ASPN (GFP-tagged) - Human asporin (ASPN), transcript variant 2

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
Aspn (NM_001014008) Rat Tagged ORF Clone
RR212463

USD 420.00

4 Weeks

Aspn (Myc-DDK-tagged ORF) - Rat asporin (Aspn), (10 ug)

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
Aspn (NM_001014008) Rat Tagged ORF Clone
RR212463L3

USD 640.00

9 Weeks

Lenti ORF clone of Aspn (Myc-DDK-tagged ORF) - Rat asporin (Aspn), (10 ug)

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Aspn (NM_001014008) Rat Tagged ORF Clone
RR212463L4

USD 700.00

9 Weeks

Lenti ORF clone of Aspn (mGFP-tagged ORF) - Rat asporin (Aspn), (10 ug)

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
Asporin (ASPN) Rabbit Polyclonal Antibody
TA344139

USD 410.00

5 Days

Rabbit Polyclonal Anti-ASPN Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ASPN antibody: synthetic peptide directed towards the middle region of human ASPN. Synthetic peptide located within the following region: NKISTVELEDFKRYKELQRLGLGNNKITDIENGSLANIPRVREIHLENNK
Aspn (NM_025711) Mouse Tagged Lenti ORF Clone
MR205760L2

USD 624.00

In Stock

Lenti ORF clone of Aspn (mGFP-tagged) - Mouse asporin (Aspn), transcript variant 1

Vector pLenti-C-mGFP
Tag mGFP
Mammalian Cell Selection None
  • LentiORF®
Asporin (ASPN) (NM_017680) Human Untagged Clone
SC304509

USD 760.00

In Stock

ASPN (untagged)-Human asporin (ASPN), transcript variant 1

Vector pCMV6-XL5
Tag Tag Free
Mammalian Cell Selection None
Asporin (ASPN) Human shRNA Plasmid Kit (Locus ID 54829)
TR306531

USD 715.00

In Stock

ASPN - Human, 4 unique 29mer shRNA constructs in retroviral untagged vector

Format Retroviral plasmids
Vector pRS
Asporin (ASPN) (NM_017680) Human Untagged Clone
SC321136

USD 760.00

In Stock

ASPN (untagged)-Human asporin (ASPN), transcript variant 1

Vector PCMV6-Neo
Tag Tag Free
Mammalian Cell Selection Neomycin
Aspn (NM_025711) Mouse Tagged ORF Clone
MR205760L1

USD 500.00

3 Weeks

Lenti ORF clone of Aspn (Myc-DDK-tagged) - Mouse asporin (Aspn), transcript variant 1

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
Mammalian Cell Selection None
  • LentiORF®
Asporin (ASPN) (NM_017680) Human Tagged ORF Clone
RC209353L2

USD 620.00

3 Weeks

Lenti ORF clone of Human asporin (ASPN), transcript variant 1, mGFP tagged

Vector pLenti-C-mGFP
Tag mGFP
Mammalian Cell Selection None
  • LentiORF®
Asporin (ASPN) Rabbit Polyclonal Antibody
TA324854

USD 450.00

5 Days

Rabbit polyclonal ASPN Antibody (Center)

Applications IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen This ASPN antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 242-269 amino acids from the Central region of human ASPN.
Asporin (ASPN) Goat Polyclonal Antibody
TA303001

USD 375.00

5 Days

Goat Polyclonal Antibody against ASPN

Applications IF, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Peptide with sequence C-IHENKVKKIQKDT, from the internal region of the protein sequence according to NP_060150.3.
Human Asporin (ASPN) activation kit by CRISPRa
GA110293

USD 1,290.00

2 Weeks

ASPN CRISPRa kit - CRISPR gene activation of human asporin

Format 3gRNAs, 1 scramble ctrl and 1 enhancer vector
Mouse Aspn activation kit by CRISPRa
GA206910

USD 1,290.00

2 Weeks

Aspn CRISPRa kit - CRISPR gene activation of mouse asporin

Format 3gRNAs, 1 scramble ctrl and 1 enhancer vector
ASPN Human qPCR Template Standard (NM_017680)
HK210553

USD 440.00

5 Days

qPCR primer pairs and template standards against Homo sapiens gene ASPN

Application Plasmid of exact quantity for transcript copy number calculation
Asporin (ASPN) Human qPCR Primer Pair (NM_017680)
HP212509

USD 120.00

5 Days

qSTAR qPCR primer pairs against Homo sapiens gene ASPN

Aspn (NM_025711) Mouse Untagged Clone
MC207593

USD 420.00

4 Weeks

Aspn (untagged) - Mouse asporin (Aspn), transcript variant 1, (10ug)

Vector pCMV6-Entry
Tag Tag Free
Mammalian Cell Selection Neomycin
Aspn (NM_001172481) Mouse Untagged Clone
MC210418

USD 420.00

4 Weeks

Aspn (untagged) - Mouse asporin (Aspn), transcript variant 2, (10ug)

Vector pCMV6-Entry
Tag Tag Free
Mammalian Cell Selection Neomycin