Products

View as table Download

Rabbit Polyclonal Anti-MAP3K2 Antibody

Applications IHC
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Synthetic peptide of human MAP3K2

Rabbit polyclonal Anti-MAP3K2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-MAP3K2 antibody: synthetic peptide directed towards the N terminal of human MAP3K2. Synthetic peptide located within the following region: AERKKRLSIIGPTSRDRSSPPPGYIPDELHQVARNGSFTSINSEGEFIPE

MAP3K2 rabbit polyclonal antibody

Applications IHC
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Synthetic peptide of human MAP3K2

MEKK2 Rabbit polyclonal Antibody

Applications WB
Reactivities Mouse
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-180 of human MEKK2 (NP_006600.3).
Modifications Unmodified

MEKK2 Rabbit polyclonal Antibody

Applications FC, IF, IHC, IP, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen A synthesized peptide derived from human MEKK2

MEKK2 Rabbit monoclonal Antibody

Applications IF, IP, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated