Germany
Japan
United Kingdom
China
Lenti ORF clone of Human MDS1 and EVI1 complex locus (MECOM), transcript variant 2, mGFP tagged
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
| Mammalian Cell Selection | None |
- LentiORF®
Products
View as table DownloadLenti ORF clone of Human MDS1 and EVI1 complex locus (MECOM), transcript variant 3, mGFP tagged
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
| Mammalian Cell Selection | None |
- LentiORF®
Lenti-ORF clone of MECOM (mGFP-tagged)-Human MDS1 and EVI1 complex locus (MECOM), transcript variant 1
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
| Mammalian Cell Selection | None |
- LentiORF®
Rabbit Polyclonal EVI1 Antibody
| Applications | ELISA |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | DNA immunization. This antibody is specific for the N Terminus Region of the target protein. |
Rabbit Polyclonal EVI1 Antibody
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | DNA immunization. This antibody was made against a protein fragment from the N Terminus Region |
Rabbit Polyclonal EVI1 Antibody
| Applications | ELISA |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | DNA immunization. This antibody is specific for the N Terminus Region of the target protein. |
MECOM HEK293T cell transient overexpression lysate (as WB positive control)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
Rabbit Polyclonal anti-EVI1 antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-EVI1 antibody: synthetic peptide directed towards the C terminal of human EVI1. Synthetic peptide located within the following region: HFTDSLKMRKMEDNQYSEAELSSFSTSHVPEELKQPLHRKSKSQAYAMML |
EVI1 (MECOM) (N-term) rabbit polyclonal antibody, Aff - Purified
| Applications | WB |
| Reactivities | Human |
| Immunogen | KLH conjugated synthetic peptide between 1-30 amino acids from the N-terminal region of Human EVI1. |
EVI1 (MECOM) (Center) rabbit polyclonal antibody, Aff - Purified
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | KLH conjugated synthetic peptide between 80-109 amino acids from the Central region of human MDS1 |
MECOM HEK293T cell transient overexpression lysate (as WB positive control)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Transient overexpression lysate of MDS1 and EVI1 complex locus (MECOM), transcript variant 2
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Goat Anti-EVI1 / AML1 (MECOM) Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-DKESLHSTSH, from the internal region of the protein sequence according to NP_001098547.3; NP_005232.2; NP_004982.2; NP_001157471.1; NP_001157472.1. |
Rabbit Polyclonal Anti-MDS1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-MDS1 antibody: synthetic peptide directed towards the N terminal of human MDS1. Synthetic peptide located within the following region: MRSKGRARKLATNNECVYGNYPEIPLEEMPDADGVASTPSLNIQEPCSPA |
MDS1 (1-169, His-tag) human protein, 0.1 mg
| Tag | His-tag |
| Expression Host | E. coli |
MDS1 (1-169, His-tag) human protein, 20 µg
| Tag | His-tag |
| Expression Host | E. coli |
Transient overexpression lysate of MDS1 and EVI1 complex locus (MECOM), transcript variant 3
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
MECOM (untagged)-Human MDS1 and EVI1 complex locus (MECOM), transcript variant 4
| Vector | pCMV6 series |
| Tag | Tag Free |
(untagged)-Human clone 26 EVI1 (EVI1) mRNA, alternatively spliced, partial cds
| Vector | pCMV6 series |
| Tag | Tag Free |
MECOM (untagged)-Human MDS1 and EVI1 complex locus (MECOM), transcript variant 3
| Vector | pCMV6-Entry |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
MECOM (untagged)-Human MDS1 and EVI1 complex locus (MECOM), transcript variant 1
| Vector | pCMV6-Entry |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
MECOM (untagged)-Human MDS1 and EVI1 complex locus (MECOM) transcript variant 6
| Vector | pCMV6-XL5 |
| Tag | Tag Free |
| Mammalian Cell Selection | None |
MECOM (untagged)-Human MDS1 and EVI1 complex locus (MECOM) transcript variant 5
| Vector | pCMV6-XL5 |
| Tag | Tag Free |
| Mammalian Cell Selection | None |
MECOM (untagged)-Human MDS1 and EVI1 complex locus (MECOM) transcript variant 1
| Vector | pCMV6-Entry |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
MECOM (untagged) - Homo sapiens MDS1 and EVI1 complex locus (MECOM), transcript variant 7
| Vector | pCMV6 series |
| Tag | Tag Free |
Transient overexpression of MECOM (NM_005241) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of MECOM (NM_001105078) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of MECOM (NM_001105077) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of MECOM (NM_001164000) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of MECOM (NM_001163999) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of MECOM (NM_004991) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of MECOM (NM_001205194) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of MECOM (NM_005241) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of MECOM (NM_005241) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack
Transient overexpression of MECOM (NM_001105078) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of MECOM (NM_001105078) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack
Transient overexpression of MECOM (NM_001105077) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of MECOM (NM_001105077) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack
Transient overexpression of MECOM (NM_001164000) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack
Transient overexpression of MECOM (NM_001163999) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack
Transient overexpression of MECOM (NM_004991) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack
Transient overexpression of MECOM (NM_001205194) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of MECOM (NM_001205194) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack
Active filters
Target Symbol
- MECOM
Pathways
- Chronic myeloid leukemia