Products

cDNA Clones (85)
Proteins (51)
Antibodies (6)
Gene Expression (4)
RNAi (4)
Jump to Filters
View as table Download
CD1E (NM_001185108) Human Tagged ORF Clone
RC231079

USD 420.00

3 Weeks

CD1E (Myc-DDK-tagged)-Human CD1e molecule (CD1E), transcript variant 9

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
CD1E (NM_001185108) Human Tagged ORF Clone
RC231079L3

USD 620.00

8 Weeks

Lenti-ORF clone of CD1E (Myc-DDK-tagged)-Human CD1e molecule (CD1E), transcript variant 9

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
CD1E (NM_001185108) Human Tagged ORF Clone
RC231079L4

USD 620.00

8 Weeks

Lenti-ORF clone of CD1E (mGFP-tagged)-Human CD1e molecule (CD1E), transcript variant 9

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
CD1E (NM_001185108) Human Tagged ORF Clone Lentiviral Particle
RC231079L4V

USD 820.00

11 Weeks

Lenti ORF particles, CD1E (mGFP-tagged)-Human CD1e molecule (CD1E), transcript variant 9, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
CD1E (NM_001185115) Human Tagged ORF Clone
RC231127L3

USD 620.00

3 Weeks

Lenti ORF clone of Human CD1e molecule (CD1E), transcript variant 8, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
CD1E (NM_001185115) Human Tagged ORF Clone
RC231127L4

USD 620.00

3 Weeks

Lenti ORF clone of Human CD1e molecule (CD1E), transcript variant 8, mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
CD1E (NM_001185115) Human Tagged ORF Clone Lentiviral Particle
RC231127L4V

USD 820.00

6 Weeks

Lenti ORF particles, CD1E (mGFP-tagged) - Human CD1e molecule (CD1E), transcript variant 8, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
CD1E (NM_001185114) Human Tagged ORF Clone
RC231132L3

USD 620.00

3 Weeks

Lenti ORF clone of Human CD1e molecule (CD1E), transcript variant 13, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
CD1E (NM_001185114) Human Tagged ORF Clone
RC231132L4

USD 620.00

3 Weeks

Lenti ORF clone of Human CD1e molecule (CD1E), transcript variant 13, mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
CD1E (NM_001185114) Human Tagged ORF Clone Lentiviral Particle
RC231132L4V

USD 820.00

6 Weeks

Lenti ORF particles, CD1E (mGFP-tagged) - Human CD1e molecule (CD1E), transcript variant 13, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
CD1E (NM_001185107) Human Tagged ORF Clone
RC231142L3

USD 620.00

3 Weeks

Lenti ORF clone of Human CD1e molecule (CD1E), transcript variant 7, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
CD1E (NM_001185107) Human Tagged ORF Clone
RC231142L4

USD 620.00

3 Weeks

Lenti ORF clone of Human CD1e molecule (CD1E), transcript variant 7, mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
CD1E (NM_001185107) Human Tagged ORF Clone Lentiviral Particle
RC231142L4V

USD 820.00

6 Weeks

Lenti ORF particles, CD1E (mGFP-tagged) - Human CD1e molecule (CD1E), transcript variant 7, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
CD1E (NM_001042584) Human Tagged ORF Clone
RG211774

USD 460.00

3 Weeks

CD1E (GFP-tagged) - Human CD1e molecule (CD1E), transcript variant 3

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
CD1E (NM_001042583) Human Tagged ORF Clone
RG219455

USD 460.00

3 Weeks

CD1E (GFP-tagged) - Human CD1e molecule (CD1E), transcript variant 2

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
CD1E (NM_001042585) Human Tagged ORF Clone
RG219500

USD 460.00

3 Weeks

CD1E (GFP-tagged) - Human CD1e molecule (CD1E), transcript variant 4

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
CD1E (NM_001042586) Human Tagged ORF Clone
RG219547

USD 460.00

3 Weeks

CD1E (GFP-tagged) - Human CD1e molecule (CD1E), transcript variant 5

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
CD1E (NM_001042587) Human Tagged ORF Clone
RG223370

USD 460.00

3 Weeks

CD1E (GFP-tagged) - Human CD1e molecule (CD1E), transcript variant 6

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
CD1E (NM_001185110) Human Tagged ORF Clone
RG230969

USD 460.00

3 Weeks

CD1E (GFP-tagged) - Human CD1e molecule (CD1E), transcript variant 12

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
CD1E (NM_001185113) Human Tagged ORF Clone
RG230987

USD 460.00

3 Weeks

CD1E (GFP-tagged) - Human CD1e molecule (CD1E), transcript variant 11

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
CD1E (NM_001185112) Human Tagged ORF Clone
RG231046

USD 460.00

3 Weeks

CD1E (GFP-tagged) - Human CD1e molecule (CD1E), transcript variant 10

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
CD1E (NM_001185108) Human Tagged ORF Clone
RG231079

USD 460.00

3 Weeks

CD1E (GFP-tagged) - Human CD1e molecule (CD1E), transcript variant 9

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
CD1E (NM_001185115) Human Tagged ORF Clone
RG231127

USD 460.00

3 Weeks

CD1E (GFP-tagged) - Human CD1e molecule (CD1E), transcript variant 8

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
CD1E (NM_001185114) Human Tagged ORF Clone
RG231132

USD 460.00

3 Weeks

CD1E (GFP-tagged) - Human CD1e molecule (CD1E), transcript variant 13

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
CD1E (NM_001185107) Human Tagged ORF Clone
RG231142

USD 460.00

3 Weeks

CD1E (GFP-tagged) - Human CD1e molecule (CD1E), transcript variant 7

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
CD1E Rabbit Polyclonal Antibody
TA343311

USD 375.00

5 Days

Rabbit Polyclonal Anti-CD1E Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CD1E antibody is: synthetic peptide directed towards the C-terminal region of Human CD1E. Synthetic peptide located within the following region: WVMWMRGEQEQRGTQRGDVLPNADETWWIFHLSHPDLFDCDSYPGHIGCS
CD1E (Center) Rabbit Polyclonal Antibody
AP50840PU-N

USD 512.00

2 Weeks

CD1E (Center) rabbit polyclonal antibody, Aff - Purified

Applications FC, IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen KLH conjugated synthetic peptide between 274-304 amino acids from the Central region of human CD1E
CD1E (NM_030893) Human Untagged Clone
SC305293

USD 660.00

In Stock

CD1E (untagged)-Human CD1e molecule (CD1E), transcript variant 1

Vector pCMV6-XL5
Tag Tag Free
Mammalian Cell Selection None
CD1E Rabbit Polyclonal Antibody
TA313573

USD 345.00

In Stock

Rabbit polyclonal anti-CD1E antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human CD1E.
CD1E (NM_001042583) Human Over-expression Lysate
LC420991

USD 121.00

In Stock

CD1E HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
CD1e (His-tag) Human Protein
AR51429PU-N

USD 845.00

2 Weeks

CD1e (His-tag) human recombinant protein, 0.5 mg

Tag His-tag
Expression Host E. coli
CD1e (His-tag) Human Protein
AR51429PU-S

USD 330.00

2 Weeks

CD1e (His-tag) human recombinant protein, 0.1 mg

Tag His-tag
Expression Host E. coli
Human CD1E activation kit by CRISPRa
GA100641

USD 1,290.00

2 Weeks

CD1E CRISPRa kit - CRISPR gene activation of human CD1e molecule

Format 3gRNAs, 1 scramble ctrl and 1 enhancer vector
CD1E Human qPCR Template Standard (NM_030893)
HK211231

USD 440.00

5 Days

qPCR primer pairs and template standards against Homo sapiens gene CD1E

Application Plasmid of exact quantity for transcript copy number calculation
CD1E Human qPCR Primer Pair (NM_030893)
HP226184

USD 120.00

5 Days

qSTAR qPCR primer pairs against Homo sapiens gene CD1E

Component 1 vial of lyophilized qSTAR qPCR primer mix (1 nmol each primer, sufficient for 200 reactions)
CD1E (NM_030893) Human Over-expression Lysate
LC403088

USD 121.00

2 Weeks

CD1E HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
CD1E (NM_001042584) Human Over-expression Lysate
LC420992

USD 121.00

2 Weeks

CD1E HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
CD1E (NM_001042585) Human Over-expression Lysate
LC420993

USD 121.00

2 Weeks

CD1E HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
CD1E (NM_001042584) Human Over-expression Lysate
LC425779

USD 121.00

2 Weeks

CD1E HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
CD1E (NM_001042585) Human Over-expression Lysate
LC425780

USD 121.00

2 Weeks

CD1E HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
CD1E (NM_001185114) Human Over-expression Lysate
LC434131

USD 121.00

2 Weeks

CD1E HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
CD1E (NM_001185107) Human Over-expression Lysate
LC434141

USD 121.00

2 Weeks

CD1E HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB