Germany
Japan
United Kingdom
China
Il4 (untagged ORF) - Rat interleukin 4 (Il4), (10 ug)
| Vector | pCMV6-Entry |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
Products
View as table DownloadIl4 (Mouse) - 3 unique 27mer siRNA duplexes - 2 nmol each
| Purity | HPLC purified |
| Number of Transfections | Approximately 330 transfections/2nmol in 24-well plate under optimized conditions (final conc. 10 nM). |
Special offer: Get $100/€100 off this product. Use code: SR100
Human IL-4 ELISA Kit (96-well)
| Assay Type | Solid Phase Sandwich ELISA |
| Format | 96-well strip plate |
| Reactivities | Human |
IL4 rabbit polyclonal antibody, Aff - Purified
| Applications | ELISA, IHC, WB |
| Reactivities | Human |
| Immunogen | Highly pure (>98%) recombinant hIL-4 (human IL-4) |
Lenti-ORF clone of IL4 (mGFP-tagged)-Human interleukin 4 (IL4), transcript variant 1
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
| Mammalian Cell Selection | None |
- LentiORF®
Lenti ORF clone of Il4 (mGFP-tagged ORF) - Rat interleukin 4 (Il4), (10 ug)
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
| Mammalian Cell Selection | None |
- LentiORF®
Rabbit polyclonal anti-IL4 antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from C-terminal of human IL4. |
Rabbit polyclonal IL4 Antibody (C-term)
| Applications | FC, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | This L4 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 122-150 amino acids from the C-terminal region of human L4. |
Il4 - Mouse, 4 unique 29mer shRNA constructs in retroviral RFP vector
| Format | Retroviral plasmids |
| Vector | pRFP-C-RS |
Recombinant protein of human Interleukin 4 (IL-4) produced in E. coli.
| Tag | Tag Free |
| Expression Host | E. coli |
Recombinant protein of human interleukin 4 (IL4), full length, with N-terminal HIS tag, expressed in E.Coli, 50ug
| Tag | N-His |
| Expression Host | E. coli |
IL4 - Human, 4 unique 29mer shRNA constructs in retroviral untagged vector
| Format | Retroviral plasmids |
| Vector | pRS |
| E. coli Selection | Ampicillin |
| Mammalian Cell Selection | Puromycin |
IL4 HEK293T cell transient overexpression lysate (as WB positive control)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Transient overexpression lysate of interleukin 4 (IL4), transcript variant 2
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
IL4 (Human) - 3 unique 27mer siRNA duplexes - 2 nmol each
| Purity | HPLC purified |
| Number of Transfections | Approximately 330 transfections/2nmol in 24-well plate under optimized conditions (final conc. 10 nM). |
Special offer: Get $100/€100 off this product. Use code: SR100
Rabbit polyclonal anti-IL-4 antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | E. coli expressed recombinant human IL-4 |
Mouse Anti-Human IL-4 Purified (50 ug)
| Reactivities | Human |
| Conjugation | Unconjugated |
Anti-Murine IL-4 Rabbit Polyclonal Antibody
| Applications | WB |
| Reactivities | Murine |
| Conjugation | Unconjugated |
| Immunogen | E.coli derived Recombinant Murine IL-4 |
Transient overexpression of IL4 (NM_172348) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack
IL4 mouse monoclonal antibody, clone B-S4, Azide Free
| Applications | FN |
| Reactivities | Human |
IL4 mouse monoclonal antibody, clone B-G28, PE
| Applications | FC |
| Reactivities | Human |
| Conjugation | PE |
IL4 mouse monoclonal antibody, clone 8F-12, Aff - Purified
| Applications | FC |
| Reactivities | Human |
IL4 mouse monoclonal antibody, clone 8F-12, PE
| Applications | FC |
| Reactivities | Human |
| Conjugation | PE |
IL4 rabbit polyclonal antibody, Aff - Purified
| Applications | WB |
| Reactivities | Human |
Rat IL-4 ELISA Kit (96-well)
| Assay Type | Solid Phase Sandwich ELISA |
| Format | 96-well strip plate |
| Reactivities | Rat |
Rabbit polyclonal anti-IL-4 antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This purified antibody was prepared from whole rabbit serum produced by repeated immunizations with full length recombinant human IL-4 protein. |
Rabbit polyclonal IL-4 antibody Peroxidase Conjugated
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This purified antibody was prepared from whole rabbit serum produced by repeated immunizations with full length recombinant human IL-4 protein. |
Rabbit polyclonal IL-4 antibody Biotin Conjugated
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This purified antibody was prepared from whole rabbit serum produced by repeated immunizations with full length recombinant human IL-4 protein. |
Rat Anti-Mouse IL-4 Purified (50 ug)
| Applications | ELISA |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
Rabbit Polyclonal Anti-IL4 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-IL4 Antibody: synthetic peptide directed towards the middle region of human IL4. Synthetic peptide located within the following region: TVLRQFYSHHEKDTRCLGATAQQFHRHKQLIRFLKRLDRNLWGLAGLNSC |
Rabbit Polyclonal Anti-IL4 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-IL4 Antibody: synthetic peptide directed towards the middle region of human IL4. Synthetic peptide located within the following region: LIRFLKRLDRNLWGLAGLNSCPVKEANQSTLENFLERLKTIMREKYSKCS |
Mouse Monoclonal Anti-IL-4 Antibody
| Reactivities | Human |
| Conjugation | Unconjugated |
Mouse Monoclonal Anti-IL-4 Antibody
| Reactivities | Rat |
| Conjugation | Unconjugated |
Mouse Monoclonal Anti-IL-4 Antibody
| Reactivities | Rat |
| Conjugation | Unconjugated |
Rabbit Polyclonal Anti-IL-4 Antibody
| Reactivities | Rat |
| Conjugation | Unconjugated |
| Immunogen | For immunization recombinant rat IL-4 (E.coli-derived) is used |
Rabbit Polyclonal Anti-IL-4 Antibody, Biotin conjugated
| Reactivities | Rat |
| Conjugation | Unconjugated |
| Immunogen | For immunization recombinant rat IL-4 (E.coli-derived) is used |
Rat Monoclonal Anti-IL-4 Antibody
| Reactivities | Mouse |
| Conjugation | Unconjugated |
Rat Monoclonal Anti-IL-4 Antibody
| Reactivities | Mouse |
| Conjugation | Unconjugated |
Mouse anti IL-4 Monoclonal Antibody
| Reactivities | Human |
| Conjugation | Unconjugated |
Human IL-4 ELISA Kit (48-well)
| Assay Type | Solid Phase Sandwich ELISA |
| Format | 48-well strip plate |
| Reactivities | Human |
Mouse IL-4 ELISA Kit (48-well)
| Assay Type | Solid Phase Sandwich ELISA |
| Format | 48-well strip plate |
| Reactivities | Mouse |
Mouse IL-4 ELISA Kit (96-well)
| Assay Type | Solid Phase Sandwich ELISA |
| Format | 96-well strip plate |
| Reactivities | Mouse |
Rat IL-4 ELISA Kit (48-well)
| Assay Type | Solid Phase Sandwich ELISA |
| Format | 48-well strip plate |
| Reactivities | Rat |
Human IL-4 ELISA Kit
| Assay Type | Sandwich ELISA kit of Quantitative Detection for Human IL-4 |
| Reactivities | Human |
Mouse IL-4 ELISA Kit
| Assay Type | Sandwich ELISA kit of Quantitative Detection for Mouse IL-4 |
| Reactivities | Mouse |
Active filters
Target Symbol
- IL4