Products

View as table Download

ABCB4 (Myc-DDK-tagged)-Human ATP-binding cassette, sub-family B (MDR/TAP), member 4 (ABCB4), transcript variant B

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®

ABCB4 (Myc-DDK-tagged)-Human ATP-binding cassette, sub-family B (MDR/TAP), member 4 (ABCB4), transcript variant A

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®

Lenti ORF particles, ABCB4 (Myc-DDK-tagged)-Human ATP-binding cassette, sub-family B (MDR/TAP), member 4 (ABCB4), transcript variant B, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
  • LentiORF®

Lenti ORF particles, ABCB4 (mGFP-tagged)-Human ATP-binding cassette, sub-family B (MDR/TAP), member 4 (ABCB4), transcript variant B, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP
Tag mGFP
  • LentiORF®

Lenti ORF particles, ABCB4 (Myc-DDK-tagged)-Human ATP-binding cassette, sub-family B (MDR/TAP), member 4 (ABCB4), transcript variant A, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
  • LentiORF®

Lenti ORF particles, ABCB4 (mGFP-tagged)-Human ATP-binding cassette, sub-family B (MDR/TAP), member 4 (ABCB4), transcript variant A, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP
Tag mGFP
  • LentiORF®

Lenti-ORF clone of ABCB4 (Myc-DDK-tagged)-Human ATP-binding cassette, sub-family B (MDR/TAP), member 4 (ABCB4), transcript variant B

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF particles, ABCB4 (Myc-DDK-tagged)-Human ATP-binding cassette, sub-family B (MDR/TAP), member 4 (ABCB4), transcript variant B, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF particles, ABCB4 (mGFP-tagged)-Human ATP-binding cassette, sub-family B (MDR/TAP), member 4 (ABCB4), transcript variant B, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

ABCB4 (Myc-DDK-tagged)-Human ATP-binding cassette, sub-family B (MDR/TAP), member 4 (ABCB4), transcript variant C

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®

Lenti-ORF clone of ABCB4 (Myc-DDK-tagged)-Human ATP-binding cassette, sub-family B (MDR/TAP), member 4 (ABCB4), transcript variant C

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF particles, ABCB4 (Myc-DDK-tagged)-Human ATP-binding cassette, sub-family B (MDR/TAP), member 4 (ABCB4), transcript variant C, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti-ORF clone of ABCB4 (mGFP-tagged)-Human ATP-binding cassette, sub-family B (MDR/TAP), member 4 (ABCB4), transcript variant C

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF particles, ABCB4 (mGFP-tagged)-Human ATP-binding cassette, sub-family B (MDR/TAP), member 4 (ABCB4), transcript variant C, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti-ORF clone of ABCB4 (Myc-DDK-tagged)-Human ATP-binding cassette, sub-family B (MDR/TAP), member 4 (ABCB4), transcript variant A

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF particles, ABCB4 (Myc-DDK-tagged)-Human ATP-binding cassette, sub-family B (MDR/TAP), member 4 (ABCB4), transcript variant A, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti-ORF clone of ABCB4 (mGFP-tagged)-Human ATP-binding cassette, sub-family B (MDR/TAP), member 4 (ABCB4), transcript variant A

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF particles, ABCB4 (mGFP-tagged)-Human ATP-binding cassette, sub-family B (MDR/TAP), member 4 (ABCB4), transcript variant A, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

ABCB4 (GFP-tagged) - Human ATP-binding cassette, sub-family B (MDR/TAP), member 4 (ABCB4), transcript variant B

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®

ABCB4 (GFP-tagged) - Human ATP-binding cassette, sub-family B (MDR/TAP), member 4 (ABCB4), transcript variant C

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®

ABCB4 (GFP-tagged) - Human ATP-binding cassette, sub-family B (MDR/TAP), member 4 (ABCB4), transcript variant A

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®

Rabbit Polyclonal Anti-ABCB4 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ABCB4 antibody: synthetic peptide directed towards the N terminal of human ABCB4. Synthetic peptide located within the following region: AGAVAEEALGAIRTVIAFGGQNKELERYQKHLENAKEIGIKKAISANISM

Lenti-ORF clone of ABCB4 (Myc-DDK-tagged)-Human ATP-binding cassette, sub-family B (MDR/TAP), member 4 (ABCB4), transcript variant B

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
Mammalian Cell Selection None
  • LentiORF®

Lenti-ORF clone of ABCB4 (mGFP-tagged)-Human ATP-binding cassette, sub-family B (MDR/TAP), member 4 (ABCB4), transcript variant B

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

Rabbit Polyclonal Anti-ABCB4 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ABCB4 antibody: synthetic peptide directed towards the middle region of human ABCB4. Synthetic peptide located within the following region: GRTCIVIAHRLSTIQNADLIVVFQNGRVKEHGTHQQLLAQKGIYFSMVSV

Lenti-ORF clone of ABCB4 (Myc-DDK-tagged)-Human ATP-binding cassette, sub-family B (MDR/TAP), member 4 (ABCB4), transcript variant A

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
Mammalian Cell Selection None
  • LentiORF®

Lenti-ORF clone of ABCB4 (mGFP-tagged)-Human ATP-binding cassette, sub-family B (MDR/TAP), member 4 (ABCB4), transcript variant B

Vector pLenti-C-mGFP
Tag mGFP
Mammalian Cell Selection None
  • LentiORF®

Lenti-ORF clone of ABCB4 (mGFP-tagged)-Human ATP-binding cassette, sub-family B (MDR/TAP), member 4 (ABCB4), transcript variant A

Vector pLenti-C-mGFP
Tag mGFP
Mammalian Cell Selection None
  • LentiORF®

ABCB4 (untagged)-Human ATP-binding cassette, sub-family B (MDR/TAP), member 4 (ABCB4), transcript variant B

Vector pCMV6-Entry
Tag Tag Free
Mammalian Cell Selection Neomycin

ABCB4 (untagged)-Human ATP-binding cassette, sub-family B (MDR/TAP), member 4 (ABCB4), transcript variant C

Vector pCMV6 series
Tag Tag Free

ABCB4 (untagged)-Human ATP-binding cassette, sub-family B (MDR/TAP), member 4 (ABCB4), transcript variant A

Vector pCMV6 series
Tag Tag Free

USD 2,000.00

4 Weeks

Transient overexpression of ABCB4 (NM_018849) in HEK293T cells paraffin embedded controls for ICC/IHC staining

USD 1,940.00

4 Weeks

Transient overexpression of ABCB4 (NM_018850) in HEK293T cells paraffin embedded controls for ICC/IHC staining

USD 1,990.00

4 Weeks

Transient overexpression of ABCB4 (NM_000443) in HEK293T cells paraffin embedded controls for ICC/IHC staining

USD 225.00

4 Weeks

Transient overexpression of ABCB4 (NM_018849) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack

USD 889.00

4 Weeks

Transient overexpression of ABCB4 (NM_018849) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack

Transient overexpression of ABCB4 (NM_018850) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack

USD 225.00

4 Weeks

Transient overexpression of ABCB4 (NM_000443) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack

USD 889.00

4 Weeks

Transient overexpression of ABCB4 (NM_000443) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack