Products

cDNA Clones (34)
Proteins (31)
Antibodies (23)
Jump to Filters
View as table Download
Glutamine Synthetase (GLUL) (NM_002065) Human Tagged ORF Clone
RG204161

USD 460.00

In Stock

GLUL (GFP-tagged) - Human glutamate-ammonia ligase (GLUL), transcript variant 1

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
Glutamine Synthetase (GLUL) (NM_001033056) Human Tagged ORF Clone
RG204039

USD 460.00

In Stock

GLUL (GFP-tagged) - Human glutamate-ammonia ligase (GLUL), transcript variant 3

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
Glutamine Synthetase (GLUL) (NM_002065) Human Untagged Clone
SC118847

USD 310.00

In Stock

GLUL (untagged)-Human glutamate-ammonia ligase (GLUL), transcript variant 1

Vector pCMV6-XL5
Tag Tag Free
Mammalian Cell Selection None
Glutamine Synthetase (GLUL) (NM_001033056) Human Tagged ORF Clone Lentiviral Particle
RC204039L3V

USD 820.00

5 Weeks

Lenti ORF particles, GLUL (Myc-DDK tagged) - Human glutamate-ammonia ligase (GLUL), transcript variant 3, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Glutamine Synthetase (GLUL) (NM_001033056) Human Tagged ORF Clone Lentiviral Particle
RC204039L4V

USD 820.00

7 Weeks

Lenti ORF particles, GLUL (mGFP-tagged) - Human glutamate-ammonia ligase (GLUL), transcript variant 3, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
Glutamine Synthetase (GLUL) (NM_002065) Human Tagged ORF Clone Lentiviral Particle
RC204161L3V

USD 820.00

3 Weeks

Lenti ORF particles, GLUL (Myc-DDK tagged) - Human glutamate-ammonia ligase (GLUL), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Glutamine Synthetase (GLUL) (NM_002065) Human Tagged ORF Clone Lentiviral Particle
RC204161L4V

USD 820.00

3 Weeks

Lenti ORF particles, GLUL (mGFP-tagged) - Human glutamate-ammonia ligase (GLUL), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
Glutamine Synthetase (GLUL) (NM_001033044) Human Tagged ORF Clone Lentiviral Particle
RC204238L3V

USD 820.00

5 Weeks

Lenti ORF particles, GLUL (Myc-DDK tagged) - Human glutamate-ammonia ligase (GLUL), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Glutamine Synthetase (GLUL) (NM_001033044) Human Tagged ORF Clone Lentiviral Particle
RC204238L4V

USD 820.00

7 Weeks

Lenti ORF particles, GLUL (mGFP-tagged) - Human glutamate-ammonia ligase (GLUL), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
Glutamine Synthetase (GLUL) (NM_001033044) Human Tagged ORF Clone
RG204238

USD 460.00

3 Weeks

GLUL (GFP-tagged) - Human glutamate-ammonia ligase (GLUL), transcript variant 2

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
Glutamine Synthetase (GLUL) Rabbit Polyclonal Antibody
TA332686

USD 374.00

3 Weeks

Rabbit anti-GLUL Polyclonal Antibody

Applications ICC/IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human GLUL
Glutamine Synthetase (GLUL) (AK092874) Human Untagged Clone
SC103453

USD 660.00

In Stock

(untagged)-Human cDNA FLJ35555 fis, clone SPLEN2004773, highly similar to GLUTAMINE SYNTHETASE (EC 6.3.1.2)

Vector pCMV6-XL4
Tag Tag Free
Mammalian Cell Selection None
Glutamine Synthetase (GLUL) (NM_002065) Human Over-expression Lysate
LY400756

USD 396.00

In Stock

Transient overexpression lysate of glutamate-ammonia ligase (glutamine synthetase) (GLUL), transcript variant 1

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
Glutamine Synthetase (GLUL) (NM_002065) Human Tagged ORF Clone
RC204161L2

USD 620.00

3 Weeks

Lenti ORF clone of Human glutamate-ammonia ligase (GLUL), transcript variant 1, mGFP tagged

Vector pLenti-C-mGFP
Tag mGFP
Mammalian Cell Selection None
  • LentiORF®
Glutamine Synthetase (GLUL) (NM_001033044) Human Tagged ORF Clone
RC204238L2

USD 620.00

3 Weeks

Lenti ORF clone of Human glutamate-ammonia ligase (GLUL), transcript variant 2, mGFP tagged

Vector pLenti-C-mGFP
Tag mGFP
Mammalian Cell Selection None
  • LentiORF®
Glutamine Synthetase (GLUL) (NM_001033056) Human Untagged Clone
SC320897

USD 760.00

In Stock

GLUL (untagged)-Human glutamate-ammonia ligase (GLUL), transcript variant 3

Vector pCMV6-AC
Tag Tag Free
Mammalian Cell Selection Neomycin
Glutamine Synthetase (GLUL) (NM_002065) Human Over-expression Lysate
LC400756

USD 121.00

In Stock

GLUL HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Glutamine Synthetase (GLUL) (NM_001033044) Human Over-expression Lysate
LC422348

USD 121.00

In Stock

GLUL HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
Glutamine Synthetase (GLUL) (NM_001033044) Human Over-expression Lysate
LY422348

USD 396.00

In Stock

Transient overexpression lysate of glutamate-ammonia ligase (glutamine synthetase) (GLUL), transcript variant 2

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
LY422348 is the same product as LY425547.
Glutamine Synthetase (GLUL) (NM_001033056) Human Over-expression Lysate
LY422357

USD 396.00

5 Days

Transient overexpression lysate of glutamate-ammonia ligase (glutamine synthetase) (GLUL), transcript variant 3

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
Glutamine Synthetase (GLUL) Rabbit Polyclonal Antibody
RA25062-100

USD 370.00

2 Weeks

Glutamine Synthetase (GLUL) rabbit polyclonal antibody

Applications IHC, WB
Reactivities Bovine, Human, Mouse, Rat
Conjugation Unconjugated
Glutamine Synthetase (GLUL) (NM_001033044) Human Untagged Clone
SC320915

USD 760.00

In Stock

GLUL (untagged)-Human glutamate-ammonia ligase (GLUL), transcript variant 2

Vector pCMV6-AC
Tag Tag Free
Mammalian Cell Selection Neomycin
Glutamine Synthetase (GLUL) Rabbit Polyclonal Antibody
TA323398

USD 345.00

4 Weeks

Anti-GLUL Rabbit Polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Peptide sequence around aa.365~369(G-D-E-P-F) derived from Human Glutamine Synthetase
Glutamine Synthetase (GLUL) (NM_002065) Human Recombinant Protein
TP750165

USD 215.00

In Stock

Purified recombinant protein of Human glutamate-ammonia ligase (GLUL), transcript variant 1, full length， with C-terminal His tag, expressed in E.coli, 50ug

Tag C-His
Expression Host E. coli
Glutamine Synthetase (GLUL) (N-term) Rabbit Polyclonal Antibody
AP17428PU-N

USD 450.00

2 Weeks

Glutamine Synthetase (GLUL) (N-term) rabbit polyclonal antibody

Applications WB
Reactivities Human, Mouse
Immunogen KLH conjugated synthetic peptide selected from the N-terminal region of human GLUL
Glutamine Synthetase (GLUL) Rabbit Polyclonal Antibody
TA301447

USD 424.00

5 Days

Rabbit Polyclonal Antibody against Glutamine Synthase

Applications WB
Reactivities Bovine, Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein.
Glutamine Synthetase (GLUL) Rabbit Polyclonal Antibody
TA342667

USD 375.00

5 Days

Rabbit Polyclonal Anti-GLUL Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-GLUL antibody: synthetic peptide directed towards the C terminal of human GLUL. Synthetic peptide located within the following region: TGFHETSNINDFSAGVANRSASIRIPRTVGQEKKGYFEDRRPSANCDPFS
Glutamine synthetase (1-373, His-tag) Human Protein
AR09562PU-L

USD 845.00

2 Weeks

Glutamine synthetase (1-373, His-tag) human recombinant protein, 0.5 mg

Tag His-tag
Expression Host E. coli
Glutamine synthetase (1-373, His-tag) Human Protein
AR09562PU-N

USD 330.00

2 Weeks

Glutamine synthetase (1-373, His-tag) human recombinant protein, 0.1 mg

Tag His-tag
Expression Host E. coli
Glutamine Synthetase (GLUL) Mouse Monoclonal Antibody [Clone ID: OTI1F4]
CF500700

USD 465.00

In Stock

Carrier-free (BSA/glycerol-free) GLUL mouse monoclonal antibody, clone OTI1F4 (formerly 1F4)

Applications FC, IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Glutamine Synthetase (GLUL) Mouse Monoclonal Antibody [Clone ID: OTI2C12]
CF814202

USD 465.00

In Stock

Carrier-free (BSA/glycerol-free) GS mouse monoclonal antibody, clone OTI2C12

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated