Germany
Japan
United Kingdom
China
GRIN2A (Myc-DDK-tagged)-Human glutamate receptor, ionotropic, N-methyl D-aspartate 2A (GRIN2A), transcript variant 1
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Products
View as table DownloadUSD 1,540.00
3 Weeks
Lenti ORF particles, GRIN2A (mGFP-tagged)-Human glutamate receptor, ionotropic, N-methyl D-aspartate 2A (GRIN2A), transcript variant 2, 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
- LentiORF®
-
GRIN2A (Myc-DDK-tagged)-Human glutamate receptor, ionotropic, N-methyl D-aspartate 2A (GRIN2A), transcript variant 2
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
USD 1,540.00
6 Weeks
Lenti ORF particles, GRIN2A (Myc-DDK-tagged)-Human glutamate receptor, ionotropic, N-methyl D-aspartate 2A (GRIN2A), transcript variant 2, 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
- LentiORF®
-
GRIN2A (GFP-tagged) - Human glutamate receptor, ionotropic, N-methyl D-aspartate 2A (GRIN2A), transcript variant 1
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
GRIN2A (GFP-tagged) - Human glutamate receptor, ionotropic, N-methyl D-aspartate 2A (GRIN2A), transcript variant 2
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti-ORF clone of GRIN2A (Myc-DDK-tagged)-Human glutamate receptor, ionotropic, N-methyl D-aspartate 2A (GRIN2A), transcript variant 2
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
USD 1,540.00
6 Weeks
Lenti ORF particles, GRIN2A (Myc-DDK-tagged)-Human glutamate receptor, ionotropic, N-methyl D-aspartate 2A (GRIN2A), transcript variant 2, 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti-ORF clone of GRIN2A (mGFP-tagged)-Human glutamate receptor, ionotropic, N-methyl D-aspartate 2A (GRIN2A), transcript variant 2
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
USD 1,540.00
6 Weeks
Lenti ORF particles, GRIN2A (mGFP-tagged)-Human glutamate receptor, ionotropic, N-methyl D-aspartate 2A (GRIN2A), transcript variant 2, 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
GRIN2A (Myc-DDK-tagged)-Human glutamate receptor, ionotropic, N-methyl D-aspartate 2A (GRIN2A), transcript variant 3
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti-ORF clone of GRIN2A (Myc-DDK-tagged)-Human glutamate receptor, ionotropic, N-methyl D-aspartate 2A (GRIN2A), transcript variant 3
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
USD 1,750.00
9 Weeks
Lenti ORF particles, GRIN2A (Myc-DDK-tagged)-Human glutamate receptor, ionotropic, N-methyl D-aspartate 2A (GRIN2A), transcript variant 3, 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti-ORF clone of GRIN2A (mGFP-tagged)-Human glutamate receptor, ionotropic, N-methyl D-aspartate 2A (GRIN2A), transcript variant 3
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
USD 1,750.00
9 Weeks
Lenti ORF particles, GRIN2A (mGFP-tagged)-Human glutamate receptor, ionotropic, N-methyl D-aspartate 2A (GRIN2A), transcript variant 3, 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti-ORF clone of GRIN2A (Myc-DDK-tagged)-Human glutamate receptor, ionotropic, N-methyl D-aspartate 2A (GRIN2A), transcript variant 1
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
USD 1,540.00
In Stock
Lenti ORF particles, GRIN2A (Myc-DDK-tagged)-Human glutamate receptor, ionotropic, N-methyl D-aspartate 2A (GRIN2A), transcript variant 1, 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
USD 1,540.00
6 Weeks
Lenti ORF particles, GRIN2A (mGFP-tagged)-Human glutamate receptor, ionotropic, N-methyl D-aspartate 2A (GRIN2A), transcript variant 1, 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
GRIN2A (GFP-tagged) - Human glutamate receptor, ionotropic, N-methyl D-aspartate 2A (GRIN2A), transcript variant 3
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
GRIN2A (untagged)-Human glutamate receptor, ionotropic, N-methyl D-aspartate 2A (GRIN2A), transcript variant 2
| Vector | pCMV6-XL4 |
| Tag | Tag Free |
| Mammalian Cell Selection | None |
Lenti-ORF clone of GRIN2A (mGFP-tagged)-Human glutamate receptor, ionotropic, N-methyl D-aspartate 2A (GRIN2A), transcript variant 1
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
GRIN2A (untagged)-Human glutamate receptor, ionotropic, N-methyl D-aspartate 2A (GRIN2A), transcript variant 1
| Vector | pCMV6-XL5 |
| Tag | Tag Free |
| Mammalian Cell Selection | None |
GRIN2A (untagged)-Human glutamate receptor, ionotropic, N-methyl D-aspartate 2A (GRIN2A), transcript variant 3
| Vector | PCMV6-Neo |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
Lenti-ORF clone of GRIN2A (Myc-DDK-tagged)-Human glutamate receptor, ionotropic, N-methyl D-aspartate 2A (GRIN2A), transcript variant 2
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
| Mammalian Cell Selection | None |
- LentiORF®
Rabbit Polyclonal Anti-GRIN2A Antibody
| Applications | IHC, WB |
| Reactivities | Human, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-GRIN2A antibody: synthetic peptide directed towards the middle region of human GRIN2A. Synthetic peptide located within the following region: DKIYTIDGEKEPGFHLDPPQFVENVTLPENVDFPDPYQDPSENFRKGDST |
Rabbit Anti-NMDA NR2A Subunit Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein from the C-terminal region of the NR2A subunit |
Rabbit Anti-NMDA NR2A Subunit Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein from the C-terminal region of the NR2A subunit |
Rabbit Polyclonal Anti-GRIN2A Antibody
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide of human GRIN2A |
Transient overexpression of GRIN2A (NM_000833) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of GRIN2A (NM_001134408) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of GRIN2A (NM_001134407) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of GRIN2A (NM_000833) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of GRIN2A (NM_000833) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack
Transient overexpression of GRIN2A (NM_001134408) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack
Transient overexpression of GRIN2A (NM_001134407) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of GRIN2A (NM_001134407) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack
Active filters
Target Symbol
- GRIN2A
Pathways
- Alzheimer's disease