Products

cDNA Clones (34)
Antibodies (17)
RNAi (11)
Proteins (8)
Gene Expression (5)
Jump to Filters
View as table Download
NMDAR2A (GRIN2A) (NM_001134407) Human Tagged ORF Clone
RC226397

USD 1,140.00

In Stock

GRIN2A (Myc-DDK-tagged)-Human glutamate receptor, ionotropic, N-methyl D-aspartate 2A (GRIN2A), transcript variant 1

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
Grin2a (NM_008170) Mouse Tagged ORF Clone
MR227135

USD 1,540.00

In Stock

Grin2a (Myc-DDK-tagged) - Mouse glutamate receptor, ionotropic, NMDA2A (epsilon 1) (Grin2a)

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
NMDAR2A (GRIN2A) (NM_000833) Human Tagged ORF Clone Lentiviral Particle
RC223136L2V

USD 1,540.00

3 Weeks

Lenti ORF particles, GRIN2A (mGFP-tagged)-Human glutamate receptor, ionotropic, N-methyl D-aspartate 2A (GRIN2A), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP
Tag mGFP
  • LentiORF®
NMDAR2A (GRIN2A) (NM_000833) Human Tagged ORF Clone
RC223136

USD 1,140.00

In Stock

GRIN2A (Myc-DDK-tagged)-Human glutamate receptor, ionotropic, N-methyl D-aspartate 2A (GRIN2A), transcript variant 2

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
NMDAR2A (GRIN2A) (NM_000833) Human Tagged ORF Clone Lentiviral Particle
RC223136L1V

USD 1,540.00

6 Weeks

Lenti ORF particles, GRIN2A (Myc-DDK-tagged)-Human glutamate receptor, ionotropic, N-methyl D-aspartate 2A (GRIN2A), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
  • LentiORF®
NMDAR2A (GRIN2A) (NM_001134407) Human Tagged ORF Clone
RG226397

USD 1,250.00

In Stock

GRIN2A (GFP-tagged) - Human glutamate receptor, ionotropic, N-methyl D-aspartate 2A (GRIN2A), transcript variant 1

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
NMDAR2A (GRIN2A) (NM_000833) Human Tagged ORF Clone
RG223136

USD 1,250.00

In Stock

GRIN2A (GFP-tagged) - Human glutamate receptor, ionotropic, N-methyl D-aspartate 2A (GRIN2A), transcript variant 2

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
Grin2a Mouse Gene Knockout Kit (CRISPR)
KN507330

USD 1,290.00

2 Weeks

Grin2a - KN2.0, Mouse gene knockout kit via CRISPR, non-homology mediated.

Format 2 gRNA vectors, 1 linear donor
Donor DNA EF1a-GFP-P2A-Puro
KN507330 is the updated version of KN307330.
Grin2a (NM_008170) Mouse Tagged ORF Clone
MG227135

USD 1,690.00

3 Weeks

Grin2a (GFP-tagged) - Mouse glutamate receptor ionotropic NMDA2A (epsilon 1) (Grin2a), (10ug)

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
Grin2a (NM_008170) Mouse Tagged ORF Clone
MR227135L3

USD 1,740.00

3 Weeks

Lenti ORF clone of Grin2a (Myc-DDK-tagged) - Mouse glutamate receptor, ionotropic, NMDA2A (epsilon 1) (Grin2a)

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Grin2a (NM_008170) Mouse Tagged ORF Clone Lentiviral Particle
MR227135L3V

USD 1,940.00

6 Weeks

Lenti ORF particles, Grin2a (Myc-DDK-tagged) - Mouse glutamate receptor, ionotropic, NMDA2A (epsilon 1) (Grin2a), 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Grin2a (NM_008170) Mouse Tagged ORF Clone
MR227135L4

USD 1,740.00

3 Weeks

Lenti ORF clone of Grin2a (mGFP-tagged) - Mouse glutamate receptor, ionotropic, NMDA2A (epsilon 1) (Grin2a)

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
Grin2a (NM_008170) Mouse Tagged ORF Clone Lentiviral Particle
MR227135L4V

USD 1,940.00

6 Weeks

Lenti ORF particles, Grin2a (GFP-tagged) - Mouse glutamate receptor, ionotropic, NMDA2A (epsilon 1) (Grin2a), 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
NMDAR2A (GRIN2A) (NM_000833) Human Tagged ORF Clone
RC223136L3

USD 1,340.00

3 Weeks

Lenti-ORF clone of GRIN2A (Myc-DDK-tagged)-Human glutamate receptor, ionotropic, N-methyl D-aspartate 2A (GRIN2A), transcript variant 2

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
NMDAR2A (GRIN2A) (NM_000833) Human Tagged ORF Clone Lentiviral Particle
RC223136L3V

USD 1,540.00

6 Weeks

Lenti ORF particles, GRIN2A (Myc-DDK-tagged)-Human glutamate receptor, ionotropic, N-methyl D-aspartate 2A (GRIN2A), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
NMDAR2A (GRIN2A) (NM_000833) Human Tagged ORF Clone
RC223136L4

USD 1,340.00

3 Weeks

Lenti-ORF clone of GRIN2A (mGFP-tagged)-Human glutamate receptor, ionotropic, N-methyl D-aspartate 2A (GRIN2A), transcript variant 2

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
NMDAR2A (GRIN2A) (NM_000833) Human Tagged ORF Clone Lentiviral Particle
RC223136L4V

USD 1,540.00

6 Weeks

Lenti ORF particles, GRIN2A (mGFP-tagged)-Human glutamate receptor, ionotropic, N-methyl D-aspartate 2A (GRIN2A), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
NMDAR2A (GRIN2A) (NM_001134408) Human Tagged ORF Clone
RC226377

USD 1,350.00

6 Weeks

GRIN2A (Myc-DDK-tagged)-Human glutamate receptor, ionotropic, N-methyl D-aspartate 2A (GRIN2A), transcript variant 3

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
NMDAR2A (GRIN2A) (NM_001134408) Human Tagged ORF Clone
RC226377L3

USD 1,550.00

6 Weeks

Lenti-ORF clone of GRIN2A (Myc-DDK-tagged)-Human glutamate receptor, ionotropic, N-methyl D-aspartate 2A (GRIN2A), transcript variant 3

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
NMDAR2A (GRIN2A) (NM_001134408) Human Tagged ORF Clone Lentiviral Particle
RC226377L3V

USD 1,750.00

9 Weeks

Lenti ORF particles, GRIN2A (Myc-DDK-tagged)-Human glutamate receptor, ionotropic, N-methyl D-aspartate 2A (GRIN2A), transcript variant 3, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
NMDAR2A (GRIN2A) (NM_001134408) Human Tagged ORF Clone
RC226377L4

USD 1,550.00

6 Weeks

Lenti-ORF clone of GRIN2A (mGFP-tagged)-Human glutamate receptor, ionotropic, N-methyl D-aspartate 2A (GRIN2A), transcript variant 3

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
NMDAR2A (GRIN2A) (NM_001134408) Human Tagged ORF Clone Lentiviral Particle
RC226377L4V

USD 1,750.00

9 Weeks

Lenti ORF particles, GRIN2A (mGFP-tagged)-Human glutamate receptor, ionotropic, N-methyl D-aspartate 2A (GRIN2A), transcript variant 3, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
NMDAR2A (GRIN2A) (NM_001134407) Human Tagged ORF Clone
RC226397L3

USD 1,340.00

In Stock

Lenti-ORF clone of GRIN2A (Myc-DDK-tagged)-Human glutamate receptor, ionotropic, N-methyl D-aspartate 2A (GRIN2A), transcript variant 1

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
NMDAR2A (GRIN2A) (NM_001134407) Human Tagged ORF Clone Lentiviral Particle
RC226397L3V

USD 1,540.00

In Stock

Lenti ORF particles, GRIN2A (Myc-DDK-tagged)-Human glutamate receptor, ionotropic, N-methyl D-aspartate 2A (GRIN2A), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
NMDAR2A (GRIN2A) (NM_001134407) Human Tagged ORF Clone Lentiviral Particle
RC226397L4V

USD 1,540.00

6 Weeks

Lenti ORF particles, GRIN2A (mGFP-tagged)-Human glutamate receptor, ionotropic, N-methyl D-aspartate 2A (GRIN2A), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
NMDAR2A (GRIN2A) (NM_001134408) Human Tagged ORF Clone
RG226377

USD 1,490.00

6 Weeks

GRIN2A (GFP-tagged) - Human glutamate receptor, ionotropic, N-methyl D-aspartate 2A (GRIN2A), transcript variant 3

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
Grin2a (NM_012573) Rat Tagged ORF Clone
RR214669

USD 2,470.00

7 Weeks

Grin2a (Myc-DDK-tagged ORF) - Rat glutamate receptor, ionotropic, N-methyl D-aspartate 2A (Grin2a), (10 ug)

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
NMDAR2A (GRIN2A) (NM_000833) Human Untagged Clone
SC122120

USD 2,980.00

In Stock

GRIN2A (untagged)-Human glutamate receptor, ionotropic, N-methyl D-aspartate 2A (GRIN2A), transcript variant 2

Vector pCMV6-XL4
Tag Tag Free
Mammalian Cell Selection None
NMDAR2A (GRIN2A) (NM_001134407) Human Tagged ORF Clone
RC226397L4

USD 1,656.00

In Stock

Lenti-ORF clone of GRIN2A (mGFP-tagged)-Human glutamate receptor, ionotropic, N-methyl D-aspartate 2A (GRIN2A), transcript variant 1

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
Grin2a Rabbit Polyclonal Antibody
TA328821

USD 585.00

2 Weeks

Rabbit Polyclonal Anti-NMDA Receptor 2A (GluN2A) (extracellular)

Applications IF, IHC, IP, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Peptide GHSHDVTERELRN(C), corresponding to amino acid residues 41-53 of rat NMDA Receptor 2A . Extracellular, N-terminus.
NMDAR2A (GRIN2A) (NM_001134407) Human Untagged Clone
SC326381

USD 2,980.00

In Stock

GRIN2A (untagged)-Human glutamate receptor, ionotropic, N-methyl D-aspartate 2A (GRIN2A), transcript variant 1

Vector pCMV6-XL5
Tag Tag Free
Mammalian Cell Selection None
NMDAR2A (GRIN2A) (C-term) Rabbit Polyclonal Antibody
AP51953PU-N

USD 450.00

2 Weeks

NMDAR2A (GRIN2A) (C-term) rabbit polyclonal antibody, Aff - Purified

Applications FC, IHC, WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide between 1291-1318 amino acids from the C-terminal region of Human NMDA Receptor 2A.
NMDAR2A (GRIN2A) (NM_001134408) Human Untagged Clone
SC325409

USD 1,100.00

In Stock

GRIN2A (untagged)-Human glutamate receptor, ionotropic, N-methyl D-aspartate 2A (GRIN2A), transcript variant 3

Vector PCMV6-Neo
Tag Tag Free
Mammalian Cell Selection Neomycin
Grin2a (NM_008170) Mouse Untagged Clone
MC224513

USD 1,980.00

In Stock

Grin2a (untagged) - Mouse glutamate receptor, ionotropic, NMDA2A (epsilon 1) (Grin2a), (10ug)

Vector pCMV6-Entry
Tag Tag Free
Mammalian Cell Selection Neomycin
NMDAR2A (GRIN2A) (NM_000833) Human Tagged ORF Clone
RC223136L1

USD 1,340.00

3 Weeks

Lenti-ORF clone of GRIN2A (Myc-DDK-tagged)-Human glutamate receptor, ionotropic, N-methyl D-aspartate 2A (GRIN2A), transcript variant 2

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
Mammalian Cell Selection None
  • LentiORF®
Grin2a Mouse Monoclonal Antibody [Clone ID: S327-95]
TA326537

USD 410.00

5 Days

Mouse Monoclonal Anti-GluN2A/NR2A Antibody

Reactivities Human, Mouse, Rat
Conjugation Unconjugated
NMDAR2A (GRIN2A) (Center) Rabbit Polyclonal Antibody
AP51952PU-N

USD 450.00

2 Weeks

NMDAR2A (GRIN2A) (Center) rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human, Mouse
Immunogen KLH conjugated synthetic peptide between 1057-1084 amino acids from the Central region of Human NMDA Receptor 2A
GRIN2A Human siRNA Oligo Duplex (Locus ID 2903)
SR301955

USD 430.00

In Stock

GRIN2A (Human) - 3 unique 27mer siRNA duplexes - 2 nmol each

Purity HPLC purified
Number of Transfections Approximately 330 transfections/2nmol in 24-well plate under optimized conditions (final conc. 10 nM).

Special offer: Get $100/€100 off this product. Use code: SR100

Grin2a Rabbit Polyclonal Antibody
TA309189

USD 415.00

5 Days

Rabbit Anti-NMDA NR2A Subunit, N-terminus Antibody

Applications WB
Reactivities Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to amino acid residues from the N-terminal region of the NR2A subunit conjugated to KLH
NMDAR2A (GRIN2A) Rabbit Polyclonal Antibody
TA338510

USD 375.00

5 Days

Rabbit Polyclonal Anti-GRIN2A Antibody

Applications IHC, WB
Reactivities Human, Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-GRIN2A antibody: synthetic peptide directed towards the middle region of human GRIN2A. Synthetic peptide located within the following region: DKIYTIDGEKEPGFHLDPPQFVENVTLPENVDFPDPYQDPSENFRKGDST
NMDAR2A (GRIN2A) (NM_001134408) Human 3' UTR Clone
SC208951

USD 560.00

4 Weeks

3`UTR clone of glutamate receptor ionotropic N-methyl D-aspartate 2A (GRIN2A) transcript variant 3 for miRNA target validation

Vector pMirTarget
Mammalian Cell Selection Neomycin
Species Human
Transfection Reporter RFP
Assay Reporter Luciferase
NMDAR2A (GRIN2A) Rabbit Polyclonal Antibody
TA309187

USD 415.00

5 Days

Rabbit Anti-NMDA NR2A Subunit Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein from the C-terminal region of the NR2A subunit
NMDAR2A (GRIN2A) Rabbit Polyclonal Antibody
TA309188

USD 365.00

5 Days

Rabbit Anti-NMDA NR2A Subunit Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein from the C-terminal region of the NR2A subunit
Grin2a Rabbit Polyclonal Antibody
TA309190

USD 415.00

5 Days

Rabbit Anti-NMDA NR2A Subunit (Tyr1325) Antibody (Phospho-Specific)

Applications WB
Reactivities Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic phospho-peptide corresponding to amino acid residues surrounding Tyr1325 conjugated to KLH
Modifications Phospho-specific
Grin2a Mouse Monoclonal Antibody [Clone ID: S327A-38]
TA326538

USD 410.00

5 Days

Mouse Monoclonal Anti-GluN2A/NR2A Antibody

Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Grin2a Rat shRNA Plasmid (Locus ID 24409)
TR709217

USD 715.00

2 Weeks

Grin2a - Rat, 4 unique 29mer shRNA constructs in retroviral untagged vector

Format Retroviral plasmids
Vector pRS
Human NMDAR2A (GRIN2A) activation kit by CRISPRa
GA101959

USD 1,290.00

2 Weeks

GRIN2A CRISPRa kit - CRISPR gene activation of human glutamate ionotropic receptor NMDA type subunit 2A

Format 3gRNAs, 1 scramble ctrl and 1 enhancer vector
Mouse Grin2a activation kit by CRISPRa
GA201741

USD 1,290.00

2 Weeks

Grin2a CRISPRa kit - CRISPR gene activation of mouse glutamate receptor, ionotropic, NMDA2A (epsilon 1)

Format 3gRNAs, 1 scramble ctrl and 1 enhancer vector
NMDAR2A (GRIN2A) Human qPCR Primer Pair (NM_000833)
HP200773

USD 120.00

5 Days

qSTAR qPCR primer pairs against Homo sapiens gene GRIN2A

Component 1 vial of lyophilized qSTAR qPCR primer mix (1 nmol each primer, sufficient for 200 reactions)
Grin2a Mouse qPCR Primer Pair (NM_008170)
MP205528

USD 120.00

5 Days

qSTAR qPCR primer pairs against Mus musculus gene Grin2a