PSEN2 (Myc-DDK-tagged)-Human presenilin 2 (Alzheimer disease 4) (PSEN2), transcript variant 2
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
PSEN2 (Myc-DDK-tagged)-Human presenilin 2 (Alzheimer disease 4) (PSEN2), transcript variant 2
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
USD 820.00
3 Weeks
Lenti ORF particles, PSEN2 (Myc-DDK tagged) - Human presenilin 2 (Alzheimer disease 4) (PSEN2), transcript variant 2, 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK |
Tag | Myc-DDK |
USD 820.00
6 Weeks
Lenti ORF particles, PSEN2 (mGFP-tagged) - Human presenilin 2 (Alzheimer disease 4) (PSEN2), transcript variant 2, 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP |
Tag | mGFP |
PSEN2 (Myc-DDK-tagged)-Human presenilin 2 (Alzheimer disease 4) (PSEN2), transcript variant 1
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
PSEN2 (GFP-tagged) - Human presenilin 2 (Alzheimer disease 4) (PSEN2), transcript variant 1
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
PSEN2 (GFP-tagged) - Human presenilin 2 (Alzheimer disease 4) (PSEN2), transcript variant 2
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
Lenti ORF clone of Human presenilin 2 (Alzheimer disease 4) (PSEN2), transcript variant 2, Myc-DDK-tagged
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
USD 820.00
7 Weeks
Lenti ORF particles, PSEN2 (Myc-DDK tagged) - Human presenilin 2 (Alzheimer disease 4) (PSEN2), transcript variant 2, 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF clone of Human presenilin 2 (Alzheimer disease 4) (PSEN2), transcript variant 2, mGFP tagged
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
USD 820.00
7 Weeks
Lenti ORF particles, PSEN2 (mGFP-tagged) - Human presenilin 2 (Alzheimer disease 4) (PSEN2), transcript variant 2, 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Lenti-ORF clone of PSEN2 (Myc-DDK-tagged)-Human presenilin 2 (Alzheimer disease 4) (PSEN2), transcript variant 1
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
USD 820.00
6 Weeks
Lenti ORF particles, PSEN2 (Myc-DDK-tagged)-Human presenilin 2 (Alzheimer disease 4) (PSEN2), transcript variant 1, 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti-ORF clone of PSEN2 (mGFP-tagged)-Human presenilin 2 (Alzheimer disease 4) (PSEN2), transcript variant 1
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
USD 820.00
6 Weeks
Lenti ORF particles, PSEN2 (mGFP-tagged)-Human presenilin 2 (Alzheimer disease 4) (PSEN2), transcript variant 1, 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
PSEN2 (untagged)-Human presenilin 2 (Alzheimer disease 4) (PSEN2), transcript variant 1
Vector | pCMV6-XL4 |
Tag | Tag Free |
Mammalian Cell Selection | None |
PSEN2 (untagged)-Human presenilin 2 (Alzheimer disease 4) (PSEN2), transcript variant 2
Vector | pCMV6-XL5 |
Tag | Tag Free |
Mammalian Cell Selection | None |
Lenti ORF clone of Human presenilin 2 (Alzheimer disease 4) (PSEN2), transcript variant 2, mGFP tagged
Vector | pLenti-C-mGFP |
Tag | mGFP |
Mammalian Cell Selection | None |
PSEN2 (untagged)-Human presenilin 2 (Alzheimer disease 4) (PSEN2), transcript variant 2
Vector | pCMV6-AC |
Tag | Tag Free |
Mammalian Cell Selection | Neomycin |
Rabbit Polyclonal Anti-PSEN2 Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-PSEN2 antibody: synthetic peptide directed towards the N terminal of human PSEN2. Synthetic peptide located within the following region: VVVATIKSVRFYTEKNGQLIYTPFTEDTPSVGQRLLNSVLNTLIMISVIV |
Transient overexpression lysate of presenilin 2 (Alzheimer disease 4) (PSEN2), transcript variant 2
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
Rabbit Polyclonal Anti-Psen2 Antibody
Applications | WB |
Reactivities | Rat |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-Psen2 antibody is: synthetic peptide directed towards the C-terminal region of Rat Psen2. Synthetic peptide located within the following region: TAQERNEPIFPALIYSSAMVWTVGMAKLDPSSQGALQLPYDPEMEEDSYD |
Mouse Monoclonal Presenilin-2 Antibody (198C679.2.)
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
PSEN2 HEK293T cell transient overexpression lysate (as WB positive control)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
Transient overexpression of PSEN2 (NM_012486) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of PSEN2 (NM_000447) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of PSEN2 (NM_012486) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of PSEN2 (NM_012486) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack
Transient overexpression of PSEN2 (NM_000447) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of PSEN2 (NM_000447) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack