Germany
Japan
United Kingdom
China
HSPA6 (Myc-DDK-tagged)-Human heat shock 70kDa protein 6 (HSP70B') (HSPA6)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
Products
View as table Download
Recombinant protein of human heat shock 70kDa protein 6 (HSP70B') (HSPA6)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
Special Offer: Get a 20% discount on this product. Use code: "MVPro20".
HSPA6 (GFP-tagged) - Human heat shock 70kDa protein 6 (HSP70B') (HSPA6)
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti ORF clone of Human heat shock 70kDa protein 6 (HSP70B') (HSPA6), Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, HSPA6 (Myc-DDK tagged) - Human heat shock 70kDa protein 6 (HSP70B') (HSPA6), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Human heat shock 70kDa protein 6 (HSP70B') (HSPA6), mGFP tagged
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, HSPA6 (mGFP-tagged) - Human heat shock 70kDa protein 6 (HSP70B') (HSPA6), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
HSPA6 (untagged)-Human heat shock 70kDa protein 6 (HSP70B') (HSPA6)
| Vector | pCMV6-Entry |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
Transient overexpression lysate of heat shock 70kDa protein 6 (HSP70B') (HSPA6)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
HSPA6 HEK293T cell transient overexpression lysate (as WB positive control)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Rabbit Polyclonal Anti-HSPA6 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-HSPA6 antibody: synthetic peptide directed towards the middle region of human HSPA6. Synthetic peptide located within the following region: EYEHQKRELEQICRPIFSRLYGGPGVPGGSSCGTQARQGDPSTGPIIEEV |
HSPA6 (1-643, His-tag) human recombinant protein, 0.5 mg
| Tag | His-tag |
| Expression Host | E. coli |
HSPA6 (1-643, His-tag) human recombinant protein, 0.1 mg
| Tag | His-tag |
| Expression Host | E. coli |
Carrier-free (BSA/glycerol-free) HSPA6 mouse monoclonal antibody, clone OTI1D12 (formerly 1D12)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
HSPA6 MS Standard C13 and N15-labeled recombinant protein (NP_002146)
| Tag | C-Myc/DDK |
| Expression Host | HEK293 |
USD 420.00
4 Weeks
USD 420.00
4 Weeks
USD 420.00
4 Weeks
HSPA6 mouse monoclonal antibody, clone OTI1D12 (formerly 1D12)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
USD 420.00
4 Weeks
HSPA6 mouse monoclonal antibody, clone OTI1D12 (formerly 1D12), Biotinylated
| Applications | WB |
| Reactivities | Human |
| Conjugation | Biotin |
HSPA6 mouse monoclonal antibody, clone OTI1D12 (formerly 1D12), HRP conjugated
| Applications | WB |
| Reactivities | Human |
| Conjugation | HRP |
HSPA6 mouse monoclonal antibody, clone OTI1D12 (formerly 1D12)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Transient overexpression of HSPA6 (NM_002155) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of HSPA6 (NM_002155) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of HSPA6 (NM_002155) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack
Active filters
Target Symbol
- HSPA6
Pathways
- Antigen processing and presentation