Germany
Japan
United Kingdom
China
RFXAP (Myc-DDK-tagged)-Human regulatory factor X-associated protein (RFXAP)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
Products
View as table Download
Lenti-ORF clone of RFXAP (Myc-DDK-tagged)-Human regulatory factor X-associated protein (RFXAP)
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, RFXAP (Myc-DDK-tagged)-Human regulatory factor X-associated protein (RFXAP), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti-ORF clone of RFXAP (mGFP-tagged)-Human regulatory factor X-associated protein (RFXAP)
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, RFXAP (mGFP-tagged)-Human regulatory factor X-associated protein (RFXAP), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
RFXAP (GFP-tagged) - Human regulatory factor X-associated protein (RFXAP)
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Rabbit Polyclonal RFX-AP Antibody
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-RFX-AP antibody: RFXAP (Regulatory factor X-associated protein), using the recombinant protein. |
RFXAP HEK293T cell transient overexpression lysate (as WB positive control)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Transient overexpression lysate of regulatory factor X-associated protein (RFXAP)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Rabbit Polyclonal Anti-RFXAP Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-RFXAP Antibody: synthetic peptide directed towards the middle region of human RFXAP. Synthetic peptide located within the following region: SDQALNCGGTASTGSAGNVKLEESADNILSIVKQRTGSFGDRPARPTLLE |
RFXAP (untagged)-Human regulatory factor X-associated protein (RFXAP)
| Vector | pCMV6-Entry |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
SC310582 is the updated version of SC119826.
Transient overexpression of RFXAP (NM_000538) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of RFXAP (NM_000538) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of RFXAP (NM_000538) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack
Active filters
Target Symbol
- RFXAP
Pathways
- Antigen processing and presentation