Products

cDNA Clones (33)
Proteins (30)
Antibodies (10)
Jump to Filters
View as table Download
Protein Kinase A regulatory subunit I alpha (PRKAR1A) (NM_002734) Human Tagged ORF Clone
RC203828

USD 420.00

In Stock

PRKAR1A (Myc-DDK-tagged)-Human protein kinase, cAMP-dependent, regulatory, type I, alpha (tissue specific extinguisher 1) (PRKAR1A), transcript variant 1

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
Protein Kinase A regulatory subunit I alpha (PRKAR1A) (NM_212471) Human Tagged ORF Clone
RC210623

USD 420.00

In Stock

PRKAR1A (Myc-DDK-tagged)-Human protein kinase, cAMP-dependent, regulatory, type I, alpha (tissue specific extinguisher 1) (PRKAR1A), transcript variant 2

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
Protein Kinase A regulatory subunit I alpha (PRKAR1A) (NM_212472) Human Tagged ORF Clone
RC212810

USD 420.00

In Stock

PRKAR1A (Myc-DDK-tagged)-Human protein kinase, cAMP-dependent, regulatory, type I, alpha (tissue specific extinguisher 1) (PRKAR1A), transcript variant 3

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
Protein Kinase A regulatory subunit I alpha (PRKAR1A) (NM_002734) Human Tagged ORF Clone Lentiviral Particle
RC203828L1V

USD 820.00

3 Weeks

Lenti ORF particles, PRKAR1A (Myc-DDK tagged) - Human protein kinase, cAMP-dependent, regulatory, type I, alpha (tissue specific extinguisher 1) (PRKAR1A), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
  • LentiORF®
Protein Kinase A regulatory subunit I alpha (PRKAR1A) (NM_002734) Human Tagged ORF Clone Lentiviral Particle
RC203828L2V

USD 820.00

6 Weeks

Lenti ORF particles, PRKAR1A (mGFP-tagged) - Human protein kinase, cAMP-dependent, regulatory, type I, alpha (tissue specific extinguisher 1) (PRKAR1A), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP
Tag mGFP
  • LentiORF®
Protein Kinase A regulatory subunit I alpha (PRKAR1A) (NM_001276289) Human Tagged ORF Clone
RC232622

USD 420.00

In Stock

PRKAR1A (Myc-DDK tagged) - Homo sapiens protein kinase, cAMP-dependent, regulatory, type I, alpha (PRKAR1A), transcript variant 4

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
Protein Kinase A regulatory subunit I alpha (PRKAR1A) (NM_002734) Human Tagged ORF Clone
RG203828

USD 460.00

In Stock

PRKAR1A (GFP-tagged) - Human protein kinase, cAMP-dependent, regulatory, type I, alpha (tissue specific extinguisher 1) (PRKAR1A), transcript variant 1

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
Protein Kinase A regulatory subunit I alpha (PRKAR1A) (NM_212472) Human Tagged ORF Clone
RG212810

USD 460.00

In Stock

PRKAR1A (GFP-tagged) - Human protein kinase, cAMP-dependent, regulatory, type I, alpha (tissue specific extinguisher 1) (PRKAR1A), transcript variant 3

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
Protein Kinase A regulatory subunit I alpha (PRKAR1A) (NM_002734) Human Tagged ORF Clone Lentiviral Particle
RC203828L3V

USD 820.00

5 Weeks

Lenti ORF particles, PRKAR1A (Myc-DDK tagged) - Human protein kinase, cAMP-dependent, regulatory, type I, alpha (tissue specific extinguisher 1) (PRKAR1A), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Protein Kinase A regulatory subunit I alpha (PRKAR1A) (NM_002734) Human Tagged ORF Clone Lentiviral Particle
RC203828L4V

USD 820.00

3 Weeks

Lenti ORF particles, PRKAR1A (mGFP-tagged) - Human protein kinase, cAMP-dependent, regulatory, type I, alpha (tissue specific extinguisher 1) (PRKAR1A), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
Protein Kinase A regulatory subunit I alpha (PRKAR1A) (NM_212471) Human Tagged ORF Clone
RC210623L3

USD 620.00

3 Weeks

Lenti ORF clone of Human protein kinase, cAMP-dependent, regulatory, type I, alpha (tissue specific extinguisher 1) (PRKAR1A), transcript variant 2, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Protein Kinase A regulatory subunit I alpha (PRKAR1A) (NM_212471) Human Tagged ORF Clone Lentiviral Particle
RC210623L3V

USD 820.00

6 Weeks

Lenti ORF particles, PRKAR1A (Myc-DDK tagged) - Human protein kinase, cAMP-dependent, regulatory, type I, alpha (tissue specific extinguisher 1) (PRKAR1A), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Protein Kinase A regulatory subunit I alpha (PRKAR1A) (NM_212471) Human Tagged ORF Clone
RC210623L4

USD 620.00

3 Weeks

Lenti ORF clone of Human protein kinase, cAMP-dependent, regulatory, type I, alpha (tissue specific extinguisher 1) (PRKAR1A), transcript variant 2, mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
Protein Kinase A regulatory subunit I alpha (PRKAR1A) (NM_212471) Human Tagged ORF Clone Lentiviral Particle
RC210623L4V

USD 820.00

6 Weeks

Lenti ORF particles, PRKAR1A (mGFP-tagged) - Human protein kinase, cAMP-dependent, regulatory, type I, alpha (tissue specific extinguisher 1) (PRKAR1A), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
Protein Kinase A regulatory subunit I alpha (PRKAR1A) (NM_212472) Human Tagged ORF Clone
RC212810L3

USD 620.00

3 Weeks

Lenti ORF clone of Human protein kinase, cAMP-dependent, regulatory, type I, alpha (tissue specific extinguisher 1) (PRKAR1A), transcript variant 3, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Protein Kinase A regulatory subunit I alpha (PRKAR1A) (NM_212472) Human Tagged ORF Clone Lentiviral Particle
RC212810L3V

USD 820.00

6 Weeks

Lenti ORF particles, PRKAR1A (Myc-DDK tagged) - Human protein kinase, cAMP-dependent, regulatory, type I, alpha (tissue specific extinguisher 1) (PRKAR1A), transcript variant 3, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Protein Kinase A regulatory subunit I alpha (PRKAR1A) (NM_212472) Human Tagged ORF Clone
RC212810L4

USD 620.00

3 Weeks

Lenti ORF clone of Human protein kinase, cAMP-dependent, regulatory, type I, alpha (tissue specific extinguisher 1) (PRKAR1A), transcript variant 3, mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
Protein Kinase A regulatory subunit I alpha (PRKAR1A) (NM_212472) Human Tagged ORF Clone Lentiviral Particle
RC212810L4V

USD 820.00

6 Weeks

Lenti ORF particles, PRKAR1A (mGFP-tagged) - Human protein kinase, cAMP-dependent, regulatory, type I, alpha (tissue specific extinguisher 1) (PRKAR1A), transcript variant 3, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
Protein Kinase A regulatory subunit I alpha (PRKAR1A) (NM_212471) Human Tagged ORF Clone
RG210623

USD 460.00

3 Weeks

PRKAR1A (GFP-tagged) - Human protein kinase, cAMP-dependent, regulatory, type I, alpha (tissue specific extinguisher 1) (PRKAR1A), transcript variant 2

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
Protein Kinase A regulatory subunit I alpha (PRKAR1A) (NM_001276289) Human Tagged ORF Clone
RG232622

USD 460.00

3 Weeks

PRKAR1A (GFP-tagged) - Homo sapiens protein kinase, cAMP-dependent, regulatory, type I, alpha (PRKAR1A), transcript variant 4

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
Protein Kinase A regulatory subunit I alpha (PRKAR1A) (NM_002734) Human Untagged Clone
SC118451

USD 310.00

In Stock

PRKAR1A (untagged)-Human protein kinase, cAMP-dependent, regulatory, type I, alpha (tissue specific extinguisher 1) (PRKAR1A), transcript variant 1

Vector pCMV6-XL5
Tag Tag Free
Mammalian Cell Selection None
Protein Kinase A regulatory subunit I alpha (PRKAR1A) (NM_002734) Human Tagged ORF Clone
RC203828L1

USD 768.00

In Stock

Lenti ORF clone of Human protein kinase, cAMP-dependent, regulatory, type I, alpha (tissue specific extinguisher 1) (PRKAR1A), transcript variant 1, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
Mammalian Cell Selection None
  • LentiORF®
Protein Kinase A regulatory subunit I alpha (PRKAR1A) Rabbit Polyclonal Antibody
TA312524

USD 345.00

In Stock

Rabbit polyclonal anti-KAP0 antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from N-terminal of human KAP0.
Protein Kinase A regulatory subunit I alpha (PRKAR1A) (NM_002734) Human Over-expression Lysate
LY400963

USD 396.00

In Stock

Transient overexpression lysate of protein kinase, cAMP-dependent, regulatory, type I, alpha (tissue specific extinguisher 1) (PRKAR1A), transcript variant 1

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB

Special Offer: Get a 20% discount on this product. Use code: "OEL20".

Protein Kinase A regulatory subunit I alpha (PRKAR1A) (NM_212472) Human Untagged Clone
SC308633

USD 650.00

In Stock

PRKAR1A (untagged)-Human protein kinase, cAMP-dependent, regulatory, type I, alpha (tissue specific extinguisher 1) (PRKAR1A), transcript variant 3

Vector pCMV6-XL4
Tag Tag Free
Mammalian Cell Selection None
Protein Kinase A regulatory subunit I alpha (PRKAR1A) Rabbit Polyclonal Antibody
TA344577

USD 475.00

5 Days

Rabbit Polyclonal Anti-PRKAR1A Antibody - C-terminal region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PRKAR1A antibody: synthetic peptide directed towards the C terminal of human PRKAR1A. Synthetic peptide located within the following region: MNRPRAATVVARGPLKCVKLDRPRFERVLGPCSDILKRNIQQYNSFVSLS
Protein Kinase A regulatory subunit I alpha (PRKAR1A) Rabbit Polyclonal Antibody
TA344578

USD 475.00

5 Days

Rabbit Polyclonal Anti-PRKAR1A Antibody - N-terminal region

Applications WB
Reactivities Mouse, Rat
Conjugation Unconjugated
Immunogen The immunogen for Anti-Prkar1a antibody is: synthetic peptide directed towards the N-terminal region of Rat Prkar1a. Synthetic peptide located within the following region: REYFERLEKEEARQIQSLQKSGIRTDSREDEISPPPPNPVVKGRRRRGAI
Protein Kinase A regulatory subunit I alpha (PRKAR1A) (NM_002734) Human Tagged ORF Clone
RC203828L2

USD 620.00

3 Weeks

Lenti ORF clone of Human protein kinase, cAMP-dependent, regulatory, type I, alpha (tissue specific extinguisher 1) (PRKAR1A), transcript variant 1, mGFP tagged

Vector pLenti-C-mGFP
Tag mGFP
Mammalian Cell Selection None
  • LentiORF®
Protein Kinase A regulatory subunit I alpha (PRKAR1A) (NM_212472) Human Over-expression Lysate
LY403945

USD 396.00

In Stock

Transient overexpression lysate of protein kinase, cAMP-dependent, regulatory, type I, alpha (tissue specific extinguisher 1) (PRKAR1A), transcript variant 3

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB

Special Offer: Get a 20% discount on this product. Use code: "OEL20".

Protein Kinase A regulatory subunit I alpha (PRKAR1A) (NM_212471) Human Over-expression Lysate
LY431006

USD 396.00

In Stock

Transient overexpression lysate of protein kinase, cAMP-dependent, regulatory, type I, alpha (tissue specific extinguisher 1) (PRKAR1A), transcript variant 2

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB

Special Offer: Get a 20% discount on this product. Use code: "OEL20".

Protein Kinase A regulatory subunit I alpha (PRKAR1A) (NM_002734) Human Untagged Clone
SC324669

USD 310.00

In Stock

PRKAR1A (untagged)-Human protein kinase, cAMP-dependent, regulatory, type I, alpha (tissue specific extinguisher 1) (PRKAR1A), transcript variant 1

Vector pCMV6-AC
Tag Tag Free
Mammalian Cell Selection Neomycin
Protein Kinase A regulatory subunit I alpha (PRKAR1A) Rabbit Polyclonal Antibody
TA324281

USD 345.00

4 Weeks

Anti-PRKAR1A Rabbit Polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein corresponding to N terminal 250 amino acids of human protein kinase, cAMP-dependent, regulatory, type I, alpha
Protein Kinase A regulatory subunit I alpha (PRKAR1A) Mouse Monoclonal Antibody [Clone ID: OTI6C7]
CF500641

USD 465.00

In Stock

Carrier-free (BSA/glycerol-free) PRKAR1A mouse monoclonal antibody, clone OTI6C7 (formerly 6C7)

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Protein Kinase A regulatory subunit I alpha (PRKAR1A) (NM_212471) Human Over-expression Lysate
LY403944

USD 396.00

5 Days

Transient overexpression lysate of protein kinase, cAMP-dependent, regulatory, type I, alpha (tissue specific extinguisher 1) (PRKAR1A), transcript variant 2

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB

Special Offer: Get a 20% discount on this product. Use code: "OEL20".

LY403944 is the same product as LY431006.
Protein Kinase A regulatory subunit I alpha (PRKAR1A) (NM_212471) Human Untagged Clone
SC308632

USD 760.00

3 Weeks

PRKAR1A (untagged)-Human protein kinase, cAMP-dependent, regulatory, type I, alpha (tissue specific extinguisher 1) (PRKAR1A), transcript variant 2

Vector pCMV6-Entry
Tag Tag Free
Mammalian Cell Selection Neomycin