PLA2G2E (Myc-DDK-tagged)-Human phospholipase A2, group IIE (PLA2G2E)
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
PLA2G2E (Myc-DDK-tagged)-Human phospholipase A2, group IIE (PLA2G2E)
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
Lenti ORF clone of Human phospholipase A2, group IIE (PLA2G2E), Myc-DDK-tagged
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, PLA2G2E (Myc-DDK tagged) - Human phospholipase A2, group IIE (PLA2G2E), 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF clone of Human phospholipase A2, group IIE (PLA2G2E), mGFP tagged
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, PLA2G2E (mGFP-tagged) - Human phospholipase A2, group IIE (PLA2G2E), 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
PLA2G2E (GFP-tagged) - Human phospholipase A2, group IIE (PLA2G2E)
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
Rabbit Polyclonal Anti-PLA2G2E Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-PLA2G2E antibody: synthetic peptide directed towards the middle region of human PLA2G2E. Synthetic peptide located within the following region: GIFCAGRTTCQRLTCECDKRAALCFRRNLGTYNRKYAHYPNKLCTGPTPP |
PLA2G2E HEK293T cell transient overexpression lysate (as WB positive control)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
Transient overexpression lysate of phospholipase A2, group IIE (PLA2G2E)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
PLA2G2E (untagged)-Human phospholipase A2, group IIE (PLA2G2E)
Vector | pCMV6-Entry |
Tag | Tag Free |
Mammalian Cell Selection | Neomycin |
Transient overexpression of PLA2G2E (NM_014589) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of PLA2G2E (NM_014589) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of PLA2G2E (NM_014589) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack