Products

cDNA Clones (19)
Proteins (11)
Antibodies (6)
Jump to Filters
View as table Download
ornithine aminotransferase (OAT) (NM_000274) Human Tagged ORF Clone
RC201610

USD 420.00

In Stock

OAT (Myc-DDK-tagged)-Human ornithine aminotransferase (OAT), nuclear gene encoding mitochondrial protein, transcript variant 1

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
ornithine aminotransferase (OAT) (NM_000274) Human Tagged ORF Clone Lentiviral Particle
RC201610L1V

USD 820.00

3 Weeks

Lenti ORF particles, OAT (Myc-DDK tagged) - Human ornithine aminotransferase (OAT), nuclear gene encoding mitochondrial protein, transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
  • LentiORF®
ornithine aminotransferase (OAT) (NM_000274) Human Tagged ORF Clone Lentiviral Particle
RC201610L2V

USD 820.00

6 Weeks

Lenti ORF particles, OAT (mGFP-tagged) - Human ornithine aminotransferase (OAT), nuclear gene encoding mitochondrial protein, transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP
Tag mGFP
  • LentiORF®
ornithine aminotransferase (OAT) (NM_000274) Human Recombinant Protein
TP301610

USD 823.00

In Stock

Purified recombinant protein of Homo sapiens ornithine aminotransferase (gyrate atrophy) (OAT), nuclear gene encoding mitochondrial protein

Tag C-Myc/DDK
Expression Host HEK293T
ornithine aminotransferase (OAT) (NM_000274) Human Tagged ORF Clone
RG201610

USD 460.00

In Stock

OAT (GFP-tagged) - Human ornithine aminotransferase (OAT), nuclear gene encoding mitochondrial protein, transcript variant 1

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
ornithine aminotransferase (OAT) (NM_000274) Human Tagged ORF Clone
RC201610L3

USD 620.00

3 Weeks

Lenti ORF clone of Human ornithine aminotransferase (OAT), nuclear gene encoding mitochondrial protein, transcript variant 1, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
ornithine aminotransferase (OAT) (NM_000274) Human Tagged ORF Clone Lentiviral Particle
RC201610L3V

USD 820.00

5 Weeks

Lenti ORF particles, OAT (Myc-DDK tagged) - Human ornithine aminotransferase (OAT), nuclear gene encoding mitochondrial protein, transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
ornithine aminotransferase (OAT) (NM_000274) Human Tagged ORF Clone
RC201610L4

USD 620.00

3 Weeks

Lenti ORF clone of Human ornithine aminotransferase (OAT), nuclear gene encoding mitochondrial protein, transcript variant 1, mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
ornithine aminotransferase (OAT) (NM_000274) Human Tagged ORF Clone Lentiviral Particle
RC201610L4V

USD 820.00

7 Weeks

Lenti ORF particles, OAT (mGFP-tagged) - Human ornithine aminotransferase (OAT), nuclear gene encoding mitochondrial protein, transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
ornithine aminotransferase (OAT) (NM_001171814) Human Tagged ORF Clone Lentiviral Particle
RC229852L3V

USD 860.00

11 Weeks

Lenti ORF particles, OAT (Myc-DDK-tagged)-Human ornithine aminotransferase (OAT), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
ornithine aminotransferase (OAT) (NM_001171814) Human Tagged ORF Clone Lentiviral Particle
RC229852L4V

USD 860.00

11 Weeks

Lenti ORF particles, OAT (mGFP-tagged)-Human ornithine aminotransferase (OAT), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
ornithine aminotransferase (OAT) Rabbit Polyclonal Antibody
TA346529

USD 475.00

5 Days

Rabbit Polyclonal Anti-OAT Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-OAT antibody: synthetic peptide directed towards the middle region of human OAT. Synthetic peptide located within the following region: RTLSAISSSTDPTSYDGFGPFMPGFDIIPYNDLPALERALQDPNVAAFMV
ornithine aminotransferase (OAT) Rabbit Polyclonal Antibody
TA346530

USD 410.00

5 Days

Rabbit Polyclonal Anti-OAT Antibody

Applications IHC, WB
Reactivities Human, Pig
Conjugation Unconjugated
Immunogen The immunogen for anti-OAT antibody: synthetic peptide directed towards the C terminal of human OAT. Synthetic peptide located within the following region: VRGKGLLNAIVIKETKDWDAWKVCLRLRDNGLLAKPTHGDIIRFAPPLVI
ornithine aminotransferase (OAT) Rabbit Polyclonal Antibody
TA314296

USD 345.00

In Stock

Rabbit polyclonal anti-OAT antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from Internal of human OAT.
ornithine aminotransferase (OAT) (NM_000274) Human Tagged ORF Clone
RC201610L1

USD 768.00

In Stock

Lenti ORF clone of Human ornithine aminotransferase (OAT), nuclear gene encoding mitochondrial protein, transcript variant 1, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
Mammalian Cell Selection None
  • LentiORF®
ornithine aminotransferase (OAT) Rabbit Polyclonal Antibody
TA325081

USD 450.00

5 Days

Rabbit polyclonal OAT Antibody (N-term)

Applications FC, IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen This OAT antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 27-55 amino acids from the N-terminal region of human OAT.
ornithine aminotransferase (OAT) (NM_000274) Human Untagged Clone
SC120012

USD 310.00

In Stock

OAT (untagged)-Human ornithine aminotransferase (OAT), nuclear gene encoding mitochondrial protein, transcript variant 1

Vector pCMV6-XL5
Tag Tag Free
Mammalian Cell Selection None
ornithine aminotransferase (OAT) (NM_000274) Human Untagged Clone
SC322198

USD 310.00

In Stock

OAT (untagged)-Human ornithine aminotransferase (OAT), nuclear gene encoding mitochondrial protein, transcript variant 1

Vector pCMV6-AC
Tag Tag Free
Mammalian Cell Selection Neomycin
ornithine aminotransferase (OAT) (NM_000274) Human Tagged ORF Clone
RC201610L2

USD 620.00

3 Weeks

Lenti ORF clone of Human ornithine aminotransferase (OAT), nuclear gene encoding mitochondrial protein, transcript variant 1, mGFP tagged

Vector pLenti-C-mGFP
Tag mGFP
Mammalian Cell Selection None
  • LentiORF®
ornithine aminotransferase (OAT) (NM_000274) Human Over-expression Lysate
LY400104

USD 396.00

5 Days

Transient overexpression lysate of ornithine aminotransferase (OAT), nuclear gene encoding mitochondrial protein, transcript variant 1

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB

Special Offer: Get a 20% discount on this product. Use code: "OEL20".

OAT (33-439) Human Protein
AR09344PU-L

USD 745.00

2 Weeks

OAT (33-439) human recombinant protein, 0.5 mg

Expression Host E. coli
OAT (33-439) Human Protein
AR09344PU-N

USD 300.00

2 Weeks

OAT (33-439) human recombinant protein, 0.1 mg

Expression Host E. coli
ornithine aminotransferase (OAT) ICC Control Block
TB401610

USD 1,070.00

4 Weeks

Transient overexpression of OAT (NM_000274) in HEK293T cells paraffin embedded controls for ICC/IHC staining

ornithine aminotransferase (OAT) ICC Control Block
TB429852

USD 1,110.00

4 Weeks

Transient overexpression of OAT (NM_001171814) in HEK293T cells paraffin embedded controls for ICC/IHC staining

ornithine aminotransferase (OAT) Cytosection
TS401610

USD 225.00

4 Weeks

Transient overexpression of OAT (NM_000274) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack

ornithine aminotransferase (OAT) Cytosection
TS401610P5

USD 889.00

4 Weeks

Transient overexpression of OAT (NM_000274) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack

ornithine aminotransferase (OAT) ICC Control Sections
TS429852P5

USD 889.00

4 Weeks

Transient overexpression of OAT (NM_001171814) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack