Products

cDNA Clones (11)
Proteins (5)
Antibodies (2)
Jump to Filters
View as table Download
SLIT1 (NM_003061) Human Tagged ORF Clone
RC218562

USD 600.00

In Stock

SLIT1 (Myc-DDK-tagged)-Human slit homolog 1 (Drosophila) (SLIT1)

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
SLIT1 (NM_003061) Human Tagged ORF Clone Lentiviral Particle
RC218562L2V

USD 1,000.00

6 Weeks

Lenti ORF particles, SLIT1 (mGFP-tagged)-Human slit homolog 1 (Drosophila) (SLIT1), 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP
Tag mGFP
  • LentiORF®
SLIT1 (NM_003061) Human Tagged ORF Clone
RC218562L3

USD 800.00

3 Weeks

Lenti-ORF clone of SLIT1 (Myc-DDK-tagged)-Human slit homolog 1 (Drosophila) (SLIT1)

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
SLIT1 (NM_003061) Human Tagged ORF Clone
RC218562L4

USD 800.00

3 Weeks

Lenti-ORF clone of SLIT1 (mGFP-tagged)-Human slit homolog 1 (Drosophila) (SLIT1)

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
SLIT1 (NM_003061) Human Tagged ORF Clone Lentiviral Particle
RC218562L4V

USD 1,000.00

7 Weeks

Lenti ORF particles, SLIT1 (mGFP-tagged)-Human slit homolog 1 (Drosophila) (SLIT1), 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
SLIT1 (NM_003061) Human Tagged ORF Clone
RG218562

USD 660.00

3 Weeks

SLIT1 (GFP-tagged) - Human slit homolog 1 (Drosophila) (SLIT1)

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
SLIT1 (NM_003061) Human Tagged Lenti ORF Clone
RC218562L1

USD 984.00

In Stock

Lenti-ORF clone of SLIT1 (Myc-DDK-tagged)-Human slit homolog 1 (Drosophila) (SLIT1)

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
Mammalian Cell Selection None
  • LentiORF®
SLIT1 Rabbit Polyclonal Antibody
TA344212

USD 475.00

5 Days

Rabbit Polyclonal Anti-SLIT1 Antibody - middle region

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-SLIT1 antibody: synthetic peptide directed towards the middle region of human SLIT1. Synthetic peptide located within the following region: GAHCVCDPGFSGELCEQESECRGDPVRDFHQVQRGYAICQTTRPLSWVEC
SLIT1 (NM_003061) Human Tagged ORF Clone
RC218562L2

USD 800.00

3 Weeks

Lenti-ORF clone of SLIT1 (mGFP-tagged)-Human slit homolog 1 (Drosophila) (SLIT1)

Vector pLenti-C-mGFP
Tag mGFP
Mammalian Cell Selection None
  • LentiORF®
SLIT1 (NM_003061) Human Over-expression Lysate
LC418922

USD 187.00

2 Weeks

SLIT1 HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
SLIT1 (NM_003061) Human Over-expression Lysate
LY418922

USD 605.00

5 Days

Transient overexpression lysate of slit homolog 1 (Drosophila) (SLIT1)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
SLIT1 (NM_003061) Human Untagged Clone
SC303271

USD 1,100.00

3 Weeks

SLIT1 (untagged)-Human slit homolog 1 (Drosophila) (SLIT1)

Vector pCMV6-Entry
Tag Tag Free
Mammalian Cell Selection Neomycin
SLIT1 Rabbit Polyclonal Antibody
TA351719

USD 345.00

In Stock

Rabbit Polyclonal Anti-SLIT1 Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide of human SLIT1
SLIT1 ICC Control Block
TB418562

USD 1,250.00

4 Weeks

Transient overexpression of SLIT1 (NM_003061) in HEK293T cells paraffin embedded controls for ICC/IHC staining

SLIT1 Cytosection
TS418562

USD 225.00

4 Weeks

Transient overexpression of SLIT1 (NM_003061) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack

SLIT1 Cytosection
TS418562P5

USD 889.00

4 Weeks

Transient overexpression of SLIT1 (NM_003061) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack