GTF2F1 (Myc-DDK-tagged)-Human general transcription factor IIF, polypeptide 1, 74kDa (GTF2F1)
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
GTF2F1 (Myc-DDK-tagged)-Human general transcription factor IIF, polypeptide 1, 74kDa (GTF2F1)
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
Recombinant protein of human general transcription factor IIF, polypeptide 1, 74kDa (GTF2F1)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
USD 820.00
3 Weeks
Lenti ORF particles, GTF2F1 (Myc-DDK tagged) - Human general transcription factor IIF, polypeptide 1, 74kDa (GTF2F1), 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK |
Tag | Myc-DDK |
USD 820.00
6 Weeks
Lenti ORF particles, GTF2F1 (mGFP-tagged) - Human general transcription factor IIF, polypeptide 1, 74kDa (GTF2F1), 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP |
Tag | mGFP |
GTF2F1 (GFP-tagged) - Human general transcription factor IIF, polypeptide 1, 74kDa (GTF2F1)
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
Lenti ORF clone of Human general transcription factor IIF, polypeptide 1, 74kDa (GTF2F1), Myc-DDK-tagged
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
USD 820.00
5 Weeks
Lenti ORF particles, GTF2F1 (Myc-DDK tagged) - Human general transcription factor IIF, polypeptide 1, 74kDa (GTF2F1), 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF clone of Human general transcription factor IIF, polypeptide 1, 74kDa (GTF2F1), mGFP tagged
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
USD 820.00
7 Weeks
Lenti ORF particles, GTF2F1 (mGFP-tagged) - Human general transcription factor IIF, polypeptide 1, 74kDa (GTF2F1), 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Lenti ORF clone of Human general transcription factor IIF, polypeptide 1, 74kDa (GTF2F1), Myc-DDK-tagged
Vector | pLenti-C-Myc-DDK |
Tag | Myc-DDK |
Mammalian Cell Selection | None |
Transient overexpression lysate of general transcription factor IIF, polypeptide 1, 74kDa (GTF2F1)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
Special Offer: Get a 20% discount on this product. Use code: "OEL20".
GTF2F1 (untagged)-Human general transcription factor IIF, polypeptide 1, 74kDa (GTF2F1)
Vector | pCMV6-XL5 |
Tag | Tag Free |
Mammalian Cell Selection | None |
Lenti ORF clone of Human general transcription factor IIF, polypeptide 1, 74kDa (GTF2F1), mGFP tagged
Vector | pLenti-C-mGFP |
Tag | mGFP |
Mammalian Cell Selection | None |
GTF2F1 HEK293T cell transient overexpression lysate (as WB positive control)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
GTF2F1 (untagged)-Human general transcription factor IIF, polypeptide 1, 74kDa (GTF2F1)
Vector | pCMV6-AC |
Tag | Tag Free |
Mammalian Cell Selection | Neomycin |
Rabbit Polyclonal Anti-GTF2F1 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-GTF2F1 antibody: synthetic peptide directed towards the N terminal of human GTF2F1. Synthetic peptide located within the following region: MAALGPSSQNVTEYVVRVPKNTTKKYNIMAFNAADKVNFATWNQARLERD |
Rabbit Polyclonal Anti-GTF2F1 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-GTF2F1 antibody: synthetic peptide directed towards the N terminal of human GTF2F1. Synthetic peptide located within the following region: DKVNFATWNQARLERDLSNKKIYQEEEMPESGAGSEFNRKLREEARRKKY |
Carrier-free (BSA/glycerol-free) GTF2F1 mouse monoclonal antibody, clone OTI1D5 (formerly 1D5)
Applications | FC, IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) GTF2F1 mouse monoclonal antibody, clone OTI1C5 (formerly 1C5)
Applications | FC, IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) GTF2F1 mouse monoclonal antibody, clone OTI2H3 (formerly 2H3)
Applications | FC, IF, WB |
Reactivities | Human, Monkey, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) GTF2F1 mouse monoclonal antibody, clone OTI4B10 (formerly 4B10)
Applications | FC, IHC, WB |
Reactivities | Human, Monkey, Mouse, Rat, Dog |
Conjugation | Unconjugated |
GTF2F1 MS Standard C13 and N15-labeled recombinant protein (NP_002087)
Tag | C-Myc/DDK |
Expression Host | HEK293 |
GTF2F1 mouse monoclonal antibody, clone OTI1D5 (formerly 1D5)
Applications | FC, IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
USD 420.00
4 Weeks
GTF2F1 mouse monoclonal antibody, clone OTI1D5 (formerly 1D5), Biotinylated
Applications | FC, IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Biotin |
USD 420.00
4 Weeks
GTF2F1 mouse monoclonal antibody, clone OTI1D5 (formerly 1D5), HRP conjugated
Applications | FC, IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | HRP |
GTF2F1 mouse monoclonal antibody, clone OTI1D5 (formerly 1D5)
Applications | FC, IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
GTF2F1 mouse monoclonal antibody, clone OTI1C5 (formerly 1C5)
Applications | FC, IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
USD 420.00
4 Weeks
GTF2F1 mouse monoclonal antibody, clone OTI1C5 (formerly 1C5), Biotinylated
Applications | FC, IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Biotin |
USD 420.00
4 Weeks
GTF2F1 mouse monoclonal antibody, clone OTI1C5 (formerly 1C5), HRP conjugated
Applications | FC, IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | HRP |
GTF2F1 mouse monoclonal antibody, clone OTI1C5 (formerly 1C5)
Applications | FC, IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
GTF2F1 mouse monoclonal antibody, clone OTI2H3 (formerly 2H3)
Applications | FC, IF, WB |
Reactivities | Human, Monkey, Mouse, Rat |
Conjugation | Unconjugated |
USD 420.00
4 Weeks
GTF2F1 mouse monoclonal antibody, clone OTI2H3 (formerly 2H3), Biotinylated
Applications | FC, IF, WB |
Reactivities | Human, Monkey, Mouse, Rat |
Conjugation | Biotin |
USD 420.00
4 Weeks
GTF2F1 mouse monoclonal antibody, clone OTI2H3 (formerly 2H3), HRP conjugated
Applications | FC, IF, WB |
Reactivities | Human, Monkey, Mouse, Rat |
Conjugation | HRP |
GTF2F1 mouse monoclonal antibody, clone OTI2H3 (formerly 2H3)
Applications | FC, IF, WB |
Reactivities | Human, Monkey, Mouse, Rat |
Conjugation | Unconjugated |
GTF2F1 mouse monoclonal antibody, clone OTI4B10 (formerly 4B10)
Applications | FC, IHC, WB |
Reactivities | Human, Monkey, Mouse, Rat, Dog |
Conjugation | Unconjugated |
USD 420.00
4 Weeks
GTF2F1 mouse monoclonal antibody, clone OTI4B10 (formerly 4B10), Biotinylated
Applications | FC, IHC, WB |
Reactivities | Human, Monkey, Mouse, Rat, Dog |
Conjugation | Biotin |
USD 420.00
4 Weeks
GTF2F1 mouse monoclonal antibody, clone OTI4B10 (formerly 4B10), HRP conjugated
Applications | FC, IHC, WB |
Reactivities | Human, Monkey, Mouse, Rat, Dog |
Conjugation | HRP |
GTF2F1 mouse monoclonal antibody, clone OTI4B10 (formerly 4B10)
Applications | FC, IHC, WB |
Reactivities | Human, Monkey, Mouse, Rat, Dog |
Conjugation | Unconjugated |
Transient overexpression of GTF2F1 (NM_002096) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of GTF2F1 (NM_002096) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of GTF2F1 (NM_002096) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack