Products

View as table Download

GTF2F1 (Myc-DDK-tagged)-Human general transcription factor IIF, polypeptide 1, 74kDa (GTF2F1)

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin

Recombinant protein of human general transcription factor IIF, polypeptide 1, 74kDa (GTF2F1)

Tag C-Myc/DDK
Expression Host HEK293T

GTF2F1 (GFP-tagged) - Human general transcription factor IIF, polypeptide 1, 74kDa (GTF2F1)

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®

Lenti ORF clone of Human general transcription factor IIF, polypeptide 1, 74kDa (GTF2F1), Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF particles, GTF2F1 (Myc-DDK tagged) - Human general transcription factor IIF, polypeptide 1, 74kDa (GTF2F1), 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF clone of Human general transcription factor IIF, polypeptide 1, 74kDa (GTF2F1), mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF particles, GTF2F1 (mGFP-tagged) - Human general transcription factor IIF, polypeptide 1, 74kDa (GTF2F1), 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF clone of Human general transcription factor IIF, polypeptide 1, 74kDa (GTF2F1), Myc-DDK-tagged

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
Mammalian Cell Selection None
  • LentiORF®

GTF2F1 (untagged)-Human general transcription factor IIF, polypeptide 1, 74kDa (GTF2F1)

Vector pCMV6-XL5
Tag Tag Free
Mammalian Cell Selection None

Lenti ORF clone of Human general transcription factor IIF, polypeptide 1, 74kDa (GTF2F1), mGFP tagged

Vector pLenti-C-mGFP
Tag mGFP
Mammalian Cell Selection None
  • LentiORF®

GTF2F1 HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T

GTF2F1 (untagged)-Human general transcription factor IIF, polypeptide 1, 74kDa (GTF2F1)

Vector pCMV6-AC
Tag Tag Free
Mammalian Cell Selection Neomycin

Rabbit Polyclonal Anti-GTF2F1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-GTF2F1 antibody: synthetic peptide directed towards the N terminal of human GTF2F1. Synthetic peptide located within the following region: MAALGPSSQNVTEYVVRVPKNTTKKYNIMAFNAADKVNFATWNQARLERD

Rabbit Polyclonal Anti-GTF2F1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-GTF2F1 antibody: synthetic peptide directed towards the N terminal of human GTF2F1. Synthetic peptide located within the following region: DKVNFATWNQARLERDLSNKKIYQEEEMPESGAGSEFNRKLREEARRKKY

Carrier-free (BSA/glycerol-free) GTF2F1 mouse monoclonal antibody, clone OTI1D5 (formerly 1D5)

Applications FC, IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) GTF2F1 mouse monoclonal antibody, clone OTI1C5 (formerly 1C5)

Applications FC, IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) GTF2F1 mouse monoclonal antibody, clone OTI2H3 (formerly 2H3)

Applications FC, IF, WB
Reactivities Human, Monkey, Mouse, Rat
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) GTF2F1 mouse monoclonal antibody, clone OTI4B10 (formerly 4B10)

Applications FC, IHC, WB
Reactivities Human, Monkey, Mouse, Rat, Dog
Conjugation Unconjugated

GTF2F1 MS Standard C13 and N15-labeled recombinant protein (NP_002087)

Tag C-Myc/DDK
Expression Host HEK293

GTF2F1 mouse monoclonal antibody, clone OTI1D5 (formerly 1D5)

Applications FC, IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

GTF2F1 mouse monoclonal antibody, clone OTI1D5 (formerly 1D5)

Applications FC, IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

GTF2F1 mouse monoclonal antibody, clone OTI1C5 (formerly 1C5)

Applications FC, IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

GTF2F1 mouse monoclonal antibody, clone OTI1C5 (formerly 1C5)

Applications FC, IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

GTF2F1 mouse monoclonal antibody, clone OTI2H3 (formerly 2H3)

Applications FC, IF, WB
Reactivities Human, Monkey, Mouse, Rat
Conjugation Unconjugated

GTF2F1 mouse monoclonal antibody, clone OTI2H3 (formerly 2H3), Biotinylated

Applications FC, IF, WB
Reactivities Human, Monkey, Mouse, Rat
Conjugation Biotin

GTF2F1 mouse monoclonal antibody, clone OTI2H3 (formerly 2H3), HRP conjugated

Applications FC, IF, WB
Reactivities Human, Monkey, Mouse, Rat
Conjugation HRP

GTF2F1 mouse monoclonal antibody, clone OTI2H3 (formerly 2H3)

Applications FC, IF, WB
Reactivities Human, Monkey, Mouse, Rat
Conjugation Unconjugated

GTF2F1 mouse monoclonal antibody, clone OTI4B10 (formerly 4B10)

Applications FC, IHC, WB
Reactivities Human, Monkey, Mouse, Rat, Dog
Conjugation Unconjugated

GTF2F1 mouse monoclonal antibody, clone OTI4B10 (formerly 4B10), Biotinylated

Applications FC, IHC, WB
Reactivities Human, Monkey, Mouse, Rat, Dog
Conjugation Biotin

GTF2F1 mouse monoclonal antibody, clone OTI4B10 (formerly 4B10), HRP conjugated

Applications FC, IHC, WB
Reactivities Human, Monkey, Mouse, Rat, Dog
Conjugation HRP

GTF2F1 mouse monoclonal antibody, clone OTI4B10 (formerly 4B10)

Applications FC, IHC, WB
Reactivities Human, Monkey, Mouse, Rat, Dog
Conjugation Unconjugated

Transient overexpression of GTF2F1 (NM_002096) in HEK293T cells paraffin embedded controls for ICC/IHC staining

Transient overexpression of GTF2F1 (NM_002096) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack

Transient overexpression of GTF2F1 (NM_002096) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack