GTF2F1 (Myc-DDK-tagged)-Human general transcription factor IIF, polypeptide 1, 74kDa (GTF2F1)
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
GTF2F1 (Myc-DDK-tagged)-Human general transcription factor IIF, polypeptide 1, 74kDa (GTF2F1)
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
Recombinant protein of human general transcription factor IIF, polypeptide 1, 74kDa (GTF2F1)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Special Offer: Get a 20% discount on this product. Use code: "MVPro20".
USD 820.00
3 Weeks
Lenti ORF particles, GTF2F1 (Myc-DDK tagged) - Human general transcription factor IIF, polypeptide 1, 74kDa (GTF2F1), 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK |
Tag | Myc-DDK |
USD 820.00
6 Weeks
Lenti ORF particles, GTF2F1 (mGFP-tagged) - Human general transcription factor IIF, polypeptide 1, 74kDa (GTF2F1), 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP |
Tag | mGFP |
GTF2F1 (GFP-tagged) - Human general transcription factor IIF, polypeptide 1, 74kDa (GTF2F1)
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
Gtf2f1 (Myc-DDK-tagged) - Mouse general transcription factor IIF, polypeptide 1 (Gtf2f1)
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
Gtf2f1 - KN2.0, Mouse gene knockout kit via CRISPR, non-homology mediated.
Format | 2 gRNA vectors, 1 linear donor |
Donor DNA | EF1a-GFP-P2A-Puro |
Gtf2f1 (GFP-tagged) - Mouse general transcription factor IIF, polypeptide 1 (Gtf2f1)
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
Lenti ORF clone of Gtf2f1 (Myc-DDK-tagged) - Mouse general transcription factor IIF, polypeptide 1 (Gtf2f1)
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, Gtf2f1 (Myc-DDK-tagged) - Mouse general transcription factor IIF, polypeptide 1 (Gtf2f1), 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF clone of Gtf2f1 (mGFP-tagged) - Mouse general transcription factor IIF, polypeptide 1 (Gtf2f1)
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, Gtf2f1 (GFP-tagged) - Mouse general transcription factor IIF, polypeptide 1 (Gtf2f1), 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Lenti ORF clone of Human general transcription factor IIF, polypeptide 1, 74kDa (GTF2F1), Myc-DDK-tagged
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
USD 820.00
5 Weeks
Lenti ORF particles, GTF2F1 (Myc-DDK tagged) - Human general transcription factor IIF, polypeptide 1, 74kDa (GTF2F1), 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF clone of Human general transcription factor IIF, polypeptide 1, 74kDa (GTF2F1), mGFP tagged
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
USD 820.00
7 Weeks
Lenti ORF particles, GTF2F1 (mGFP-tagged) - Human general transcription factor IIF, polypeptide 1, 74kDa (GTF2F1), 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Gtf2f1 (Myc-DDK-tagged ORF) - Rat general transcription factor IIF, polypeptide 1 (Gtf2f1), (10 ug)
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
Lenti ORF clone of Gtf2f1 (Myc-DDK-tagged ORF) - Rat general transcription factor IIF, polypeptide 1 (Gtf2f1), (10 ug)
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, Gtf2f1 (Myc-DDK-tagged ORF) - Rat general transcription factor IIF, polypeptide 1 (Gtf2f1), 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF clone of Gtf2f1 (mGFP-tagged ORF) - Rat general transcription factor IIF, polypeptide 1 (Gtf2f1), (10 ug)
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, Gtf2f1 (GFP-tagged ORF) - Rat general transcription factor IIF, polypeptide 1 (Gtf2f1), 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Lenti ORF clone of Human general transcription factor IIF, polypeptide 1, 74kDa (GTF2F1), Myc-DDK-tagged
Vector | pLenti-C-Myc-DDK |
Tag | Myc-DDK |
Mammalian Cell Selection | None |
Transient overexpression lysate of general transcription factor IIF, polypeptide 1, 74kDa (GTF2F1)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
GTF2F1 (untagged)-Human general transcription factor IIF, polypeptide 1, 74kDa (GTF2F1)
Vector | pCMV6-XL5 |
Tag | Tag Free |
Mammalian Cell Selection | None |
Lenti ORF clone of Human general transcription factor IIF, polypeptide 1, 74kDa (GTF2F1), mGFP tagged
Vector | pLenti-C-mGFP |
Tag | mGFP |
Mammalian Cell Selection | None |
GTF2F1 HEK293T cell transient overexpression lysate (as WB positive control)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Gtf2f1 (untagged) - Mouse general transcription factor IIF, polypeptide 1 (Gtf2f1), (10ug)
Vector | PCMV6-Kan/Neo |
Tag | Tag Free |
Mammalian Cell Selection | Neomycin |
Gtf2f1 (untagged) - Mouse general transcription factor IIF, polypeptide 1 (Gtf2f1), (10ug)
Vector | PCMV6-Kan/Neo |
Tag | Tag Free |
Mammalian Cell Selection | Neomycin |
GTF2F1 (untagged)-Human general transcription factor IIF, polypeptide 1, 74kDa (GTF2F1)
Vector | pCMV6-AC |
Tag | Tag Free |
Mammalian Cell Selection | Neomycin |
Rabbit Polyclonal Anti-GTF2F1 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-GTF2F1 antibody: synthetic peptide directed towards the N terminal of human GTF2F1. Synthetic peptide located within the following region: MAALGPSSQNVTEYVVRVPKNTTKKYNIMAFNAADKVNFATWNQARLERD |
Rabbit Polyclonal Anti-GTF2F1 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-GTF2F1 antibody: synthetic peptide directed towards the N terminal of human GTF2F1. Synthetic peptide located within the following region: DKVNFATWNQARLERDLSNKKIYQEEEMPESGAGSEFNRKLREEARRKKY |
Carrier-free (BSA/glycerol-free) GTF2F1 mouse monoclonal antibody, clone OTI1D5 (formerly 1D5)
Applications | FC, IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) GTF2F1 mouse monoclonal antibody, clone OTI1C5 (formerly 1C5)
Applications | FC, IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) GTF2F1 mouse monoclonal antibody, clone OTI2H3 (formerly 2H3)
Applications | FC, IF, WB |
Reactivities | Human, Monkey, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) GTF2F1 mouse monoclonal antibody, clone OTI4B10 (formerly 4B10)
Applications | FC, IHC, WB |
Reactivities | Human, Monkey, Mouse, Rat, Dog |
Conjugation | Unconjugated |
GTF2F1 CRISPRa kit - CRISPR gene activation of human general transcription factor IIF subunit 1
Format | 3gRNAs, 1 scramble ctrl and 1 enhancer vector |
qPCR primer pairs and template standards against Homo sapiens gene GTF2F1
Application | Plasmid of exact quantity for transcript copy number calculation |
qSTAR qPCR primer pairs against Homo sapiens gene GTF2F1
Component | 1 vial of lyophilized qSTAR qPCR primer mix (1 nmol each primer, sufficient for 200 reactions) |
qPCR primer pairs and template standards against Mus musculus gene Gtf2f1
Application | Plasmid of exact quantity for transcript copy number calculation |
qPCR primer pairs and template standards against Mus musculus gene Gtf2f1
Application | Plasmid of exact quantity for transcript copy number calculation |
qSTAR qPCR primer pairs against Mus musculus gene Gtf2f1
GTF2F1 MS Standard C13 and N15-labeled recombinant protein (NP_002087)
Tag | C-Myc/DDK |
Expression Host | HEK293 |
Gtf2f1 (untagged ORF) - Rat general transcription factor IIF, polypeptide 1 (Gtf2f1), (10 ug)
Vector | pCMV6-Entry |
Tag | Tag Free |
Mammalian Cell Selection | Neomycin |
3`UTR clone of general transcription factor IIF polypeptide 1 74kDa (GTF2F1) for miRNA target validation
Vector | pMirTarget |
Mammalian Cell Selection | Neomycin |
Species | Human |
Transfection Reporter | RFP |
Assay Reporter | Luciferase |
GTF2F1 (Human) - 3 unique 27mer siRNA duplexes - 2 nmol each
Purity | HPLC purified |
Number of Transfections | Approximately 330 transfections/2nmol in 24-well plate under optimized conditions (final conc. 10 nM). |
Special offer: Get $100/€100 off this product. Use code: SR100
Gtf2f1 (Mouse) - 3 unique 27mer siRNA duplexes - 2 nmol each
Purity | HPLC purified |
Number of Transfections | Approximately 330 transfections/2nmol in 24-well plate under optimized conditions (final conc. 10 nM). |
Special offer: Get $100/€100 off this product. Use code: SR100
GTF2F1 rabbit polyclonal antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human GTF2F1 |
GTF2F1 rabbit polyclonal antibody
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human GTF2F1 |
GTF2F1 Rabbit polyclonal Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human GTF2F1. |
GTF2F1 Rabbit polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 340-505 of human GTF2F1 (NP_002087.2). |
Modifications | Unmodified |