Products

cDNA Clones (27)
Antibodies (26)
RNAi (11)
Proteins (8)
Gene Expression (7)
Jump to Filters
View as table Download
TFIIF (GTF2F1) (NM_002096) Human Tagged ORF Clone
RC201294

USD 420.00

In Stock

GTF2F1 (Myc-DDK-tagged)-Human general transcription factor IIF, polypeptide 1, 74kDa (GTF2F1)

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
TFIIF (GTF2F1) (NM_002096) Human Recombinant Protein
TP301294

USD 823.00

In Stock

Recombinant protein of human general transcription factor IIF, polypeptide 1, 74kDa (GTF2F1)

Tag C-Myc/DDK
Expression Host HEK293T
TFIIF (GTF2F1) (NM_002096) Human Tagged ORF Clone
RG201294

USD 460.00

In Stock

GTF2F1 (GFP-tagged) - Human general transcription factor IIF, polypeptide 1, 74kDa (GTF2F1)

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
Gtf2f1 (NM_133801) Mouse Tagged ORF Clone
MR208172

USD 470.00

In Stock

Gtf2f1 (Myc-DDK-tagged) - Mouse general transcription factor IIF, polypeptide 1 (Gtf2f1)

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
Gtf2f1 Mouse Gene Knockout Kit (CRISPR)
KN507419

USD 1,290.00

2 Weeks

Gtf2f1 - KN2.0, Mouse gene knockout kit via CRISPR, non-homology mediated.

Format 2 gRNA vectors, 1 linear donor
Donor DNA EF1a-GFP-P2A-Puro
KN507419 is the updated version of KN307419.
Gtf2f1 (NM_133801) Mouse Tagged ORF Clone
MG208172

USD 520.00

3 Weeks

Gtf2f1 (GFP-tagged) - Mouse general transcription factor IIF, polypeptide 1 (Gtf2f1)

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
Gtf2f1 (NM_133801) Mouse Tagged ORF Clone
MR208172L3

USD 670.00

3 Weeks

Lenti ORF clone of Gtf2f1 (Myc-DDK-tagged) - Mouse general transcription factor IIF, polypeptide 1 (Gtf2f1)

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Gtf2f1 (NM_133801) Mouse Tagged ORF Clone Lentiviral Particle
MR208172L3V

USD 870.00

6 Weeks

Lenti ORF particles, Gtf2f1 (Myc-DDK-tagged) - Mouse general transcription factor IIF, polypeptide 1 (Gtf2f1), 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Gtf2f1 (NM_133801) Mouse Tagged ORF Clone
MR208172L4

USD 670.00

3 Weeks

Lenti ORF clone of Gtf2f1 (mGFP-tagged) - Mouse general transcription factor IIF, polypeptide 1 (Gtf2f1)

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
Gtf2f1 (NM_133801) Mouse Tagged ORF Clone Lentiviral Particle
MR208172L4V

USD 870.00

6 Weeks

Lenti ORF particles, Gtf2f1 (GFP-tagged) - Mouse general transcription factor IIF, polypeptide 1 (Gtf2f1), 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
TFIIF (GTF2F1) (NM_002096) Human Tagged ORF Clone
RC201294L3

USD 620.00

3 Weeks

Lenti ORF clone of Human general transcription factor IIF, polypeptide 1, 74kDa (GTF2F1), Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
TFIIF (GTF2F1) (NM_002096) Human Tagged ORF Clone Lentiviral Particle
RC201294L3V

USD 820.00

5 Weeks

Lenti ORF particles, GTF2F1 (Myc-DDK tagged) - Human general transcription factor IIF, polypeptide 1, 74kDa (GTF2F1), 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
TFIIF (GTF2F1) (NM_002096) Human Tagged ORF Clone
RC201294L4

USD 620.00

3 Weeks

Lenti ORF clone of Human general transcription factor IIF, polypeptide 1, 74kDa (GTF2F1), mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
TFIIF (GTF2F1) (NM_002096) Human Tagged ORF Clone Lentiviral Particle
RC201294L4V

USD 820.00

7 Weeks

Lenti ORF particles, GTF2F1 (mGFP-tagged) - Human general transcription factor IIF, polypeptide 1, 74kDa (GTF2F1), 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
Gtf2f1 (NM_001007711) Rat Tagged ORF Clone
RR201688

USD 690.00

5 Weeks

Gtf2f1 (Myc-DDK-tagged ORF) - Rat general transcription factor IIF, polypeptide 1 (Gtf2f1), (10 ug)

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
Gtf2f1 (NM_001007711) Rat Tagged ORF Clone
RR201688L3

USD 890.00

9 Weeks

Lenti ORF clone of Gtf2f1 (Myc-DDK-tagged ORF) - Rat general transcription factor IIF, polypeptide 1 (Gtf2f1), (10 ug)

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Gtf2f1 (NM_001007711) Rat Tagged ORF Clone Lentiviral Particle
RR201688L3V

USD 1,100.00

13 Weeks

Lenti ORF particles, Gtf2f1 (Myc-DDK-tagged ORF) - Rat general transcription factor IIF, polypeptide 1 (Gtf2f1), 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Gtf2f1 (NM_001007711) Rat Tagged ORF Clone
RR201688L4

USD 970.00

9 Weeks

Lenti ORF clone of Gtf2f1 (mGFP-tagged ORF) - Rat general transcription factor IIF, polypeptide 1 (Gtf2f1), (10 ug)

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
Gtf2f1 (NM_001007711) Rat Tagged ORF Clone Lentiviral Particle
RR201688L4V

USD 1,240.00

13 Weeks

Lenti ORF particles, Gtf2f1 (GFP-tagged ORF) - Rat general transcription factor IIF, polypeptide 1 (Gtf2f1), 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
TFIIF (GTF2F1) (NM_002096) Human Tagged ORF Clone
RC201294L1

USD 768.00

In Stock

Lenti ORF clone of Human general transcription factor IIF, polypeptide 1, 74kDa (GTF2F1), Myc-DDK-tagged

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
Mammalian Cell Selection None
  • LentiORF®
TFIIF (GTF2F1) (NM_002096) Human Untagged Clone
SC118829

USD 310.00

In Stock

GTF2F1 (untagged)-Human general transcription factor IIF, polypeptide 1, 74kDa (GTF2F1)

Vector pCMV6-XL5
Tag Tag Free
Mammalian Cell Selection None
TFIIF (GTF2F1) (NM_002096) Human Tagged ORF Clone
RC201294L2

USD 620.00

3 Weeks

Lenti ORF clone of Human general transcription factor IIF, polypeptide 1, 74kDa (GTF2F1), mGFP tagged

Vector pLenti-C-mGFP
Tag mGFP
Mammalian Cell Selection None
  • LentiORF®
TFIIF (GTF2F1) (NM_002096) Human Over-expression Lysate
LC400767

USD 121.00

In Stock

GTF2F1 HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Gtf2f1 (NM_133801) Mouse Untagged Clone
MC201827

USD 210.00

In Stock

Gtf2f1 (untagged) - Mouse general transcription factor IIF, polypeptide 1 (Gtf2f1), (10ug)

Vector PCMV6-Kan/Neo
Tag Tag Free
Mammalian Cell Selection Neomycin
Gtf2f1 (NM_133801) Mouse Untagged Clone
MC201828

USD 210.00

In Stock

Gtf2f1 (untagged) - Mouse general transcription factor IIF, polypeptide 1 (Gtf2f1), (10ug)

Vector PCMV6-Kan/Neo
Tag Tag Free
Mammalian Cell Selection Neomycin
TFIIF (GTF2F1) (NM_002096) Human Untagged Clone
SC320316

USD 310.00

In Stock

GTF2F1 (untagged)-Human general transcription factor IIF, polypeptide 1, 74kDa (GTF2F1)

Vector pCMV6-AC
Tag Tag Free
Mammalian Cell Selection Neomycin
TFIIF (GTF2F1) Rabbit Polyclonal Antibody
TA330080

USD 375.00

5 Days

Rabbit Polyclonal Anti-GTF2F1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-GTF2F1 antibody: synthetic peptide directed towards the N terminal of human GTF2F1. Synthetic peptide located within the following region: MAALGPSSQNVTEYVVRVPKNTTKKYNIMAFNAADKVNFATWNQARLERD
TFIIF (GTF2F1) Rabbit Polyclonal Antibody
TA335218

USD 375.00

5 Days

Rabbit Polyclonal Anti-GTF2F1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-GTF2F1 antibody: synthetic peptide directed towards the N terminal of human GTF2F1. Synthetic peptide located within the following region: DKVNFATWNQARLERDLSNKKIYQEEEMPESGAGSEFNRKLREEARRKKY
TFIIF (GTF2F1) Mouse Monoclonal Antibody [Clone ID: OTI1D5]
CF503372

USD 465.00

4 Weeks

Carrier-free (BSA/glycerol-free) GTF2F1 mouse monoclonal antibody, clone OTI1D5 (formerly 1D5)

Applications FC, IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
TFIIF (GTF2F1) Mouse Monoclonal Antibody [Clone ID: OTI1C5]
CF503373

USD 465.00

4 Weeks

Carrier-free (BSA/glycerol-free) GTF2F1 mouse monoclonal antibody, clone OTI1C5 (formerly 1C5)

Applications FC, IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
TFIIF (GTF2F1) Mouse Monoclonal Antibody [Clone ID: OTI2H3]
CF503380

USD 465.00

4 Weeks

Carrier-free (BSA/glycerol-free) GTF2F1 mouse monoclonal antibody, clone OTI2H3 (formerly 2H3)

Applications FC, IF, WB
Reactivities Human, Monkey, Mouse, Rat
Conjugation Unconjugated
TFIIF (GTF2F1) Mouse Monoclonal Antibody [Clone ID: OTI4B10]
CF503604

USD 465.00

4 Weeks

Carrier-free (BSA/glycerol-free) GTF2F1 mouse monoclonal antibody, clone OTI4B10 (formerly 4B10)

Applications FC, IHC, WB
Reactivities Human, Monkey, Mouse, Rat, Dog
Conjugation Unconjugated
Human TFIIF (GTF2F1) activation kit by CRISPRa
GA102007

USD 1,290.00

2 Weeks

GTF2F1 CRISPRa kit - CRISPR gene activation of human general transcription factor IIF subunit 1

Format 3gRNAs, 1 scramble ctrl and 1 enhancer vector
TFIIF (GTF2F1) Human qPCR Template Standard (NM_002096)
HK203564

USD 330.00

5 Days

qPCR primer pairs and template standards against Homo sapiens gene GTF2F1

Application Plasmid of exact quantity for transcript copy number calculation
TFIIF (GTF2F1) Human qPCR Primer Pair (NM_002096)
HP205837

USD 120.00

5 Days

qSTAR qPCR primer pairs against Homo sapiens gene GTF2F1

Component 1 vial of lyophilized qSTAR qPCR primer mix (1 nmol each primer, sufficient for 200 reactions)
Gtf2f1 Mouse qPCR Template Standard (NM_133801)
MK201392

USD 330.00

5 Days

qPCR primer pairs and template standards against Mus musculus gene Gtf2f1

Application Plasmid of exact quantity for transcript copy number calculation
Gtf2f1 Mouse qPCR Template Standard (NM_133801)
MK201393

USD 330.00

5 Days

qPCR primer pairs and template standards against Mus musculus gene Gtf2f1

Application Plasmid of exact quantity for transcript copy number calculation
Gtf2f1 Mouse qPCR Primer Pair (NM_133801)
MP205420

USD 120.00

5 Days

qSTAR qPCR primer pairs against Mus musculus gene Gtf2f1

TFIIF (GTF2F1) (NM_002096) Human Mass Spec Standard
PH301294

USD 2,055.00

3 Weeks

GTF2F1 MS Standard C13 and N15-labeled recombinant protein (NP_002087)

Tag C-Myc/DDK
Expression Host HEK293
Gtf2f1 (NM_001007711) Rat Untagged Clone
RN201688

USD 690.00

5 Weeks

Gtf2f1 (untagged ORF) - Rat general transcription factor IIF, polypeptide 1 (Gtf2f1), (10 ug)

Vector pCMV6-Entry
Tag Tag Free
Mammalian Cell Selection Neomycin
TFIIF (GTF2F1) (NM_002096) Human 3' UTR Clone
SC209187

USD 560.00

4 Weeks

3`UTR clone of general transcription factor IIF polypeptide 1 74kDa (GTF2F1) for miRNA target validation

Vector pMirTarget
Mammalian Cell Selection Neomycin
Species Human
Transfection Reporter RFP
Assay Reporter Luciferase
GTF2F1 Human siRNA Oligo Duplex (Locus ID 2962)
SR302003

USD 430.00

2 Weeks

GTF2F1 (Human) - 3 unique 27mer siRNA duplexes - 2 nmol each

Purity HPLC purified
Number of Transfections Approximately 330 transfections/2nmol in 24-well plate under optimized conditions (final conc. 10 nM).

Special offer: Get $100/€100 off this product. Use code: SR100

Gtf2f1 Mouse siRNA Oligo Duplex (Locus ID 98053)
SR416304

USD 430.00

2 Weeks

Gtf2f1 (Mouse) - 3 unique 27mer siRNA duplexes - 2 nmol each

Purity HPLC purified
Number of Transfections Approximately 330 transfections/2nmol in 24-well plate under optimized conditions (final conc. 10 nM).
GTF2F1 Rabbit Polyclonal Antibody
TA365887

USD 380.00

4 Weeks

GTF2F1 rabbit polyclonal antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human GTF2F1
GTF2F1 Rabbit Polyclonal Antibody
TA370230

USD 380.00

4 Weeks

GTF2F1 rabbit polyclonal antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human GTF2F1
TFIIF (GTF2F1) Rabbit Polyclonal Antibody
TA376849

USD 275.00

3 Weeks

GTF2F1 Rabbit polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human GTF2F1.
TFIIF (GTF2F1) Rabbit Polyclonal Antibody
TA376850

USD 220.00

3 Weeks

GTF2F1 Rabbit polyclonal Antibody

Applications IHC, WB
Reactivities Human, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 340-505 of human GTF2F1 (NP_002087.2).
Modifications Unmodified