Products

View as table Download

ACOX3 (Myc-DDK-tagged)-Human acyl-CoA oxidase 3, pristanoyl (ACOX3), transcript variant 1

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin

Lenti ORF particles, ACOX3 (Myc-DDK tagged) - Human acyl-CoA oxidase 3, pristanoyl (ACOX3), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
  • LentiORF®

Lenti ORF particles, ACOX3 (mGFP-tagged) - Human acyl-CoA oxidase 3, pristanoyl (ACOX3), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP
Tag mGFP
  • LentiORF®

ACOX3 (GFP-tagged) - Human acyl-CoA oxidase 3, pristanoyl (ACOX3), transcript variant 1

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®

Lenti ORF clone of Human acyl-CoA oxidase 3, pristanoyl (ACOX3), transcript variant 1, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF particles, ACOX3 (Myc-DDK tagged) - Human acyl-CoA oxidase 3, pristanoyl (ACOX3), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF clone of Human acyl-CoA oxidase 3, pristanoyl (ACOX3), transcript variant 1, mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF particles, ACOX3 (mGFP-tagged) - Human acyl-CoA oxidase 3, pristanoyl (ACOX3), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

ACOX3 (Myc-DDK-tagged)-Human acyl-CoA oxidase 3, pristanoyl (ACOX3), transcript variant 2

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®

Lenti-ORF clone of ACOX3 (Myc-DDK-tagged)-Human acyl-CoA oxidase 3, pristanoyl (ACOX3), transcript variant 2

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF particles, ACOX3 (Myc-DDK-tagged)-Human acyl-CoA oxidase 3, pristanoyl (ACOX3), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti-ORF clone of ACOX3 (mGFP-tagged)-Human acyl-CoA oxidase 3, pristanoyl (ACOX3), transcript variant 2

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF particles, ACOX3 (mGFP-tagged)-Human acyl-CoA oxidase 3, pristanoyl (ACOX3), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

ACOX3 (GFP-tagged) - Human acyl-CoA oxidase 3, pristanoyl (ACOX3), transcript variant 2

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®

Lenti ORF clone of Human acyl-CoA oxidase 3, pristanoyl (ACOX3), transcript variant 1, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
Mammalian Cell Selection None
  • LentiORF®

Lenti ORF clone of Human acyl-CoA oxidase 3, pristanoyl (ACOX3), transcript variant 1, mGFP tagged

Vector pLenti-C-mGFP
Tag mGFP
Mammalian Cell Selection None
  • LentiORF®

Rabbit Polyclonal antibody to ACOX3 (acyl-Coenzyme A oxidase 3, pristanoyl)

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant protein fragment contain a sequence corresponding to a region within amino acids 408 and 603 of ACOX3

ACOX3 (untagged)-Human acyl-CoA oxidase 3, pristanoyl (ACOX3), transcript variant 1

Vector pCMV6-XL5
Tag Tag Free
Mammalian Cell Selection None

Rabbit Polyclonal Anti-ACOX3 Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-ACOX3 antibody: synthetic peptide directed towards the C terminal of human ACOX3. Synthetic peptide located within the following region: SWTTQQGIQECREACGGHGYLAMNRLGVLRDDNDPNCTYEGDNNILLQQT

ACOX3 HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T

ACOX3 MS Standard C13 and N15-labeled recombinant protein (NP_003492)

Tag C-Myc/DDK
Expression Host HEK293

ACOX3 (untagged)-Human acyl-CoA oxidase 3, pristanoyl (ACOX3), transcript variant 2

Vector pCMV6 series
Tag Tag Free

Anti-ACOX3 Rabbit Polyclonal Antibody

Applications ELISA, IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein corresponding to a region derived from 325-625 amino acids of human acyl-CoA oxidase 3, pristanoyl

Anti-ACOX3 Rabbit Polyclonal Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein corresponding to a region derived from 325-625 amino acids of human acyl-CoA oxidase 3, pristanoyl

Transient overexpression of ACOX3 (NM_003501) in HEK293T cells paraffin embedded controls for ICC/IHC staining

Transient overexpression of ACOX3 (NM_001101667) in HEK293T cells paraffin embedded controls for ICC/IHC staining

USD 225.00

4 Weeks

Transient overexpression of ACOX3 (NM_003501) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack

USD 889.00

4 Weeks

Transient overexpression of ACOX3 (NM_003501) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack

Transient overexpression of ACOX3 (NM_001101667) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack