ACOX3 (Myc-DDK-tagged)-Human acyl-CoA oxidase 3, pristanoyl (ACOX3), transcript variant 1
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
ACOX3 (Myc-DDK-tagged)-Human acyl-CoA oxidase 3, pristanoyl (ACOX3), transcript variant 1
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
Lenti ORF particles, ACOX3 (Myc-DDK tagged) - Human acyl-CoA oxidase 3, pristanoyl (ACOX3), transcript variant 1, 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK |
Tag | Myc-DDK |
Lenti ORF particles, ACOX3 (mGFP-tagged) - Human acyl-CoA oxidase 3, pristanoyl (ACOX3), transcript variant 1, 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP |
Tag | mGFP |
ACOX3 (GFP-tagged) - Human acyl-CoA oxidase 3, pristanoyl (ACOX3), transcript variant 1
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
Lenti ORF clone of Human acyl-CoA oxidase 3, pristanoyl (ACOX3), transcript variant 1, Myc-DDK-tagged
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, ACOX3 (Myc-DDK tagged) - Human acyl-CoA oxidase 3, pristanoyl (ACOX3), transcript variant 1, 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF clone of Human acyl-CoA oxidase 3, pristanoyl (ACOX3), transcript variant 1, mGFP tagged
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, ACOX3 (mGFP-tagged) - Human acyl-CoA oxidase 3, pristanoyl (ACOX3), transcript variant 1, 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
ACOX3 (Myc-DDK-tagged)-Human acyl-CoA oxidase 3, pristanoyl (ACOX3), transcript variant 2
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
Lenti-ORF clone of ACOX3 (Myc-DDK-tagged)-Human acyl-CoA oxidase 3, pristanoyl (ACOX3), transcript variant 2
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, ACOX3 (Myc-DDK-tagged)-Human acyl-CoA oxidase 3, pristanoyl (ACOX3), transcript variant 2, 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti-ORF clone of ACOX3 (mGFP-tagged)-Human acyl-CoA oxidase 3, pristanoyl (ACOX3), transcript variant 2
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, ACOX3 (mGFP-tagged)-Human acyl-CoA oxidase 3, pristanoyl (ACOX3), transcript variant 2, 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
ACOX3 (GFP-tagged) - Human acyl-CoA oxidase 3, pristanoyl (ACOX3), transcript variant 2
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
Lenti ORF clone of Human acyl-CoA oxidase 3, pristanoyl (ACOX3), transcript variant 1, Myc-DDK-tagged
Vector | pLenti-C-Myc-DDK |
Tag | Myc-DDK |
Mammalian Cell Selection | None |
Transient overexpression lysate of acyl-Coenzyme A oxidase 3, pristanoyl (ACOX3), transcript variant 1
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
Special Offer: Get a 20% discount on this product. Use code: "OEL20".
Lenti ORF clone of Human acyl-CoA oxidase 3, pristanoyl (ACOX3), transcript variant 1, mGFP tagged
Vector | pLenti-C-mGFP |
Tag | mGFP |
Mammalian Cell Selection | None |
Rabbit Polyclonal antibody to ACOX3 (acyl-Coenzyme A oxidase 3, pristanoyl)
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Recombinant protein fragment contain a sequence corresponding to a region within amino acids 408 and 603 of ACOX3 |
ACOX3 (untagged)-Human acyl-CoA oxidase 3, pristanoyl (ACOX3), transcript variant 1
Vector | pCMV6-XL5 |
Tag | Tag Free |
Mammalian Cell Selection | None |
Rabbit Polyclonal Anti-ACOX3 Antibody
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-ACOX3 antibody: synthetic peptide directed towards the C terminal of human ACOX3. Synthetic peptide located within the following region: SWTTQQGIQECREACGGHGYLAMNRLGVLRDDNDPNCTYEGDNNILLQQT |
ACOX3 HEK293T cell transient overexpression lysate (as WB positive control)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
ACOX3 MS Standard C13 and N15-labeled recombinant protein (NP_003492)
Tag | C-Myc/DDK |
Expression Host | HEK293 |
ACOX3 (untagged)-Human acyl-CoA oxidase 3, pristanoyl (ACOX3), transcript variant 2
Vector | pCMV6 series |
Tag | Tag Free |
Anti-ACOX3 Rabbit Polyclonal Antibody
Applications | ELISA, IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein corresponding to a region derived from 325-625 amino acids of human acyl-CoA oxidase 3, pristanoyl |
Anti-ACOX3 Rabbit Polyclonal Antibody
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein corresponding to a region derived from 325-625 amino acids of human acyl-CoA oxidase 3, pristanoyl |
Transient overexpression of ACOX3 (NM_003501) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of ACOX3 (NM_001101667) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of ACOX3 (NM_003501) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of ACOX3 (NM_003501) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack
Transient overexpression of ACOX3 (NM_001101667) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack