Products

cDNA Clones (11)
Proteins (7)
Antibodies (3)
Jump to Filters
View as table Download
OXCT1 (NM_000436) Human Tagged ORF Clone
RC203764

USD 420.00

In Stock

OXCT1 (Myc-DDK-tagged)-Human 3-oxoacid CoA transferase 1 (OXCT1), nuclear gene encoding mitochondrial protein

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
OXCT1 (NM_000436) Human Tagged ORF Clone Lentiviral Particle
RC203764L1V

USD 820.00

3 Weeks

Lenti ORF particles, OXCT1 (Myc-DDK tagged) - Human 3-oxoacid CoA transferase 1 (OXCT1), nuclear gene encoding mitochondrial protein, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
  • LentiORF®
OXCT1 (NM_000436) Human Tagged ORF Clone Lentiviral Particle
RC203764L2V

USD 820.00

6 Weeks

Lenti ORF particles, OXCT1 (mGFP-tagged) - Human 3-oxoacid CoA transferase 1 (OXCT1), nuclear gene encoding mitochondrial protein, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP
Tag mGFP
  • LentiORF®
OXCT1 (NM_000436) Human Tagged ORF Clone
RG203764

USD 460.00

In Stock

OXCT1 (GFP-tagged) - Human 3-oxoacid CoA transferase 1 (OXCT1), nuclear gene encoding mitochondrial protein

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
OXCT1 (NM_000436) Human Tagged ORF Clone
RC203764L3

USD 620.00

3 Weeks

Lenti ORF clone of Human 3-oxoacid CoA transferase 1 (OXCT1), nuclear gene encoding mitochondrial protein, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
OXCT1 (NM_000436) Human Tagged ORF Clone Lentiviral Particle
RC203764L3V

USD 820.00

6 Weeks

Lenti ORF particles, OXCT1 (Myc-DDK tagged) - Human 3-oxoacid CoA transferase 1 (OXCT1), nuclear gene encoding mitochondrial protein, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
OXCT1 (NM_000436) Human Tagged ORF Clone
RC203764L4

USD 620.00

3 Weeks

Lenti ORF clone of Human 3-oxoacid CoA transferase 1 (OXCT1), nuclear gene encoding mitochondrial protein, mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
OXCT1 (NM_000436) Human Tagged ORF Clone Lentiviral Particle
RC203764L4V

USD 820.00

6 Weeks

Lenti ORF particles, OXCT1 (mGFP-tagged) - Human 3-oxoacid CoA transferase 1 (OXCT1), nuclear gene encoding mitochondrial protein, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
OXCT1 Rabbit Polyclonal Antibody
TA346672

USD 475.00

5 Days

Rabbit Polyclonal Anti-OXCT1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-OXCT1 antibody: synthetic peptide directed towards the N terminal of human OXCT1. Synthetic peptide located within the following region: TLAERIRAGGAGVPAFYTPTGYGTLVQEGGSPIKYNKDGSVAIASKPREV
OXCT1 Rabbit Polyclonal Antibody
TA346673

USD 475.00

5 Days

Rabbit Polyclonal Anti-OXCT1 Antibody

Applications WB
Reactivities Human, Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-OXCT1 antibody: synthetic peptide directed towards the middle region of human OXCT1. Synthetic peptide located within the following region: GMYANLGIGIPLLASNFISPNITVHLQSENGVLGLGPYPRQHEADADLIN
OXCT1 (NM_000436) Human Tagged ORF Clone
RC203764L1

USD 620.00

In Stock

Lenti ORF clone of Human 3-oxoacid CoA transferase 1 (OXCT1), nuclear gene encoding mitochondrial protein, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
Mammalian Cell Selection None
  • LentiORF®
OXCT1 (NM_000436) Human Tagged ORF Clone
RC203764L2

USD 620.00

3 Weeks

Lenti ORF clone of Human 3-oxoacid CoA transferase 1 (OXCT1), nuclear gene encoding mitochondrial protein, mGFP tagged

Vector pLenti-C-mGFP
Tag mGFP
Mammalian Cell Selection None
  • LentiORF®
OXCT1 (NM_000436) Human Untagged Clone
SC119890

USD 310.00

In Stock

OXCT1 (untagged)-Human 3-oxoacid CoA transferase 1 (OXCT1), nuclear gene encoding mitochondrial protein

Vector pCMV6-XL5
Tag Tag Free
Mammalian Cell Selection None
OXCT1 (NM_000436) Human Over-expression Lysate
LY400157

USD 396.00

5 Days

Transient overexpression lysate of 3-oxoacid CoA transferase 1 (OXCT1), nuclear gene encoding mitochondrial protein

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
OXCT1 (NM_000436) Human Over-expression Lysate
LC400157

USD 121.00

2 Weeks

OXCT1 HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
OXCT1 (NM_000436) Human Mass Spec Standard
PH303764

USD 2,055.00

3 Weeks

OXCT1 MS Standard C13 and N15-labeled recombinant protein (NP_000427)

Tag C-Myc/DDK
Expression Host HEK293
OXCT1 Rabbit Polyclonal Antibody
TA350257

USD 345.00

In Stock

Rabbit Polyclonal Anti-OXCT1 Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human OXCT1
OXCT1 ICC Control Block
TB403764

USD 1,070.00

4 Weeks

Transient overexpression of OXCT1 (NM_000436) in HEK293T cells paraffin embedded controls for ICC/IHC staining

OXCT1 Cytosection
TS403764

USD 225.00

4 Weeks

Transient overexpression of OXCT1 (NM_000436) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack

OXCT1 Cytosection
TS403764P5

USD 889.00

4 Weeks

Transient overexpression of OXCT1 (NM_000436) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack