F2R (Myc-DDK-tagged)-Human coagulation factor II (thrombin) receptor (F2R)
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
F2R (Myc-DDK-tagged)-Human coagulation factor II (thrombin) receptor (F2R)
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
USD 820.00
3 Weeks
Lenti ORF particles, F2R (Myc-DDK tagged) - Human coagulation factor II (thrombin) receptor (F2R), 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK |
Tag | Myc-DDK |
USD 820.00
6 Weeks
Lenti ORF particles, F2R (mGFP-tagged) - Human coagulation factor II (thrombin) receptor (F2R), 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP |
Tag | mGFP |
F2R (GFP-tagged) - Human coagulation factor II (thrombin) receptor (F2R)
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
USD 820.00
5 Weeks
Lenti ORF particles, F2R (Myc-DDK tagged) - Human coagulation factor II (thrombin) receptor (F2R), 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
F2R (untagged)-Human coagulation factor II (thrombin) receptor (F2R)
Vector | pCMV6-XL5 |
Tag | Tag Free |
Mammalian Cell Selection | None |
Lenti ORF clone of Human coagulation factor II (thrombin) receptor (F2R), Myc-DDK-tagged
Vector | pLenti-C-Myc-DDK |
Tag | Myc-DDK |
Mammalian Cell Selection | None |
Goat Anti-F2R / PAR1 Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence C-TRARRPESKATNAT, from the Internal region (near N-terminus) of the protein sequence according to NP_001983.2. |
Mouse Monoclonal Thrombin Receptor Antibody (N2-11)
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
F2R HEK293T cell transient overexpression lysate (as WB positive control)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Rabbit Polyclonal Anti-Human Protease-activated Receptor-1 (extracellular)
Applications | FC, IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Peptide (C)KNESGLTEYRLVSINK, corresponding to amino acid residues 61-76 of human PAR-1. Extracellular, N terminal. |
Rabbit Polyclonal Anti-Thrombin Receptor Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-Thrombin Receptor Antibody: A synthesized peptide derived from human Thrombin Receptor |
Thrombin Receptor (F2R) (24-37) goat polyclonal antibody, Aff - Purified
Applications | ELISA, IHC, WB |
Reactivities | Human |
Immunogen | Synthetic peptide from the Internal region (near N-terminus) of the human protein sequence according to NP_001983.2 |
Transient overexpression lysate of coagulation factor II (thrombin) receptor (F2R)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
Lenti ORF clone of Human coagulation factor II (thrombin) receptor (F2R), mGFP tagged
Vector | pLenti-C-mGFP |
Tag | mGFP |
Mammalian Cell Selection | None |
Rabbit polyclonal Thrombin Receptor antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human Thrombin Receptor. |
Rabbit polyclonal F2R / PAR1 (Cleaved-Ser42) antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from human PAR1. |
Rabbit Polyclonal Thrombin Receptor Antibody
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | DNA immunization. In vivo generated recombinant protein fragment. |
(untagged)-Homo sapiens, Similar to coagulation factor II (thrombin) receptor, clone IMAGE:4849569
Vector | pCMV6-XL4 |
Tag | Tag Free |
Mammalian Cell Selection | None |
Thrombin Receptor (F2R) rabbit polyclonal antibody, Aff - Purified
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Rabbit Polyclonal Anti-F2R Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-F2R antibody: synthetic peptide directed towards the N terminal of human F2R. |
Rabbit Polyclonal Anti-F2R Antibody (N-Terminus)
Applications | IHC |
Reactivities | Human |
Immunogen | F2R / Thrombin Receptor / PAR1 antibody was raised against synthetic 19 amino acid peptide from N-terminal extracellular domain of human Thrombin Receptor. Percent identity with other species by BLAST analysis: Human, Gibbon, Baboon, Monkey (100%); Gorilla (95%). |
Rabbit Polyclonal Anti-F2R Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-F2R antibody: synthetic peptide directed towards the C terminal of human F2R. Synthetic peptide located within the following region: YAYYFSAFSAVFFFVPLIISTVCYVSIIRCLSSSAVANRSKKSRALFLSA |
USD 820.00
3 Weeks
Lenti ORF particles, F2R (mGFP-tagged) - Human coagulation factor II (thrombin) receptor (F2R), 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Anti-F2R Rabbit Polyclonal Antibody
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide corresponding to a region derived from 56-70 amino acids of human coagulation factor II (thrombin) receptor |
Anti-F2R Rabbit Polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide corresponding to a region derived from 56-70 amino acids of human coagulation factor II (thrombin) receptor |
Transient overexpression of F2R (NM_001992) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of F2R (NM_001992) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of F2R (NM_001992) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack