Germany
Japan
United Kingdom
China
P2RX7 (Myc-DDK-tagged)-Human purinergic receptor P2X, ligand-gated ion channel, 7 (P2RX7), transcript variant 1
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
Products
View as table Download
P2RX7 (GFP-tagged) - Human purinergic receptor P2X, ligand-gated ion channel, 7 (P2RX7), transcript variant 1
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti ORF particles, P2RX7 (Myc-DDK tagged) - Human purinergic receptor P2X, ligand-gated ion channel, 7 (P2RX7), transcript variant 1, 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
- LentiORF®
-
Lenti ORF particles, P2RX7 (mGFP-tagged) - Human purinergic receptor P2X, ligand-gated ion channel, 7 (P2RX7), transcript variant 1, 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
- LentiORF®
-
Lenti ORF clone of Human purinergic receptor P2X, ligand-gated ion channel, 7 (P2RX7), transcript variant 1, mGFP tagged
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
P2RX7 (untagged)-Human purinergic receptor P2X, ligand-gated ion channel, 7 (P2RX7), transcript variant 1
| Vector | pCMV6-XL5 |
| Tag | Tag Free |
| Mammalian Cell Selection | None |
Lenti ORF particles, P2RX7 (Myc-DDK tagged) - Human purinergic receptor P2X, ligand-gated ion channel, 7 (P2RX7), transcript variant 1, 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF particles, P2RX7 (mGFP-tagged) - Human purinergic receptor P2X, ligand-gated ion channel, 7 (P2RX7), transcript variant 1, 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Human purinergic receptor P2X, ligand-gated ion channel, 7 (P2RX7), transcript variant 1, Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF clone of Human purinergic receptor P2X, ligand-gated ion channel, 7 (P2RX7), transcript variant 1, Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
| Mammalian Cell Selection | None |
- LentiORF®
Goat Anti-P2RX7 / P2X7 receptor Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence YETNKVTRIQSMNY-C, from the N-Terminus of the protein sequence according to NP_002553.2. |
Transient overexpression lysate of purinergic receptor P2X, ligand-gated ion channel, 7 (P2RX7)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Rabbit Polyclonal Anti-PDIA1 Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | PDIA1 antibody was raised against a 17 amino acid peptide near the center of human PDIA1. |
P2RX7 HEK293T cell transient overexpression lysate (as WB positive control)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
Lenti ORF clone of Human purinergic receptor P2X, ligand-gated ion channel, 7 (P2RX7), transcript variant 1, mGFP tagged
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
| Mammalian Cell Selection | None |
- LentiORF®
(untagged)-Human mRNA for P2X purinoceptor 7 variant protein
| Vector | pCMV6-XL5 |
| Tag | Tag Free |
| Mammalian Cell Selection | None |
P2X7 Rabbit Polyclonal (Internal) Antibody
| Applications | IHC |
| Reactivities | Human, Monkey, Gibbon |
| Immunogen | P2RX7 / P2X7 antibody was raised against synthetic 16 amino acid peptide from internal region of human P2RX7 / P2X7. Percent identity with other species by BLAST analysis: Human, Gibbon, Monkey (100%); Marmoset, Pig (88%); Mouse, Horse (81%). |
Rabbit Polyclonal Anti-P2RX7 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-P2RX7 antibody: synthetic peptide directed towards the middle region of human P2RX7. Synthetic peptide located within the following region: LRHCAYRCYATWRFGSQDMADFANLPSCCRWRIRKEFPKSEGQYSGFKSP |
Rabbit Polyclonal Anti-P2RX7 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-P2RX7 antibody: synthetic peptide directed towards the middle region of human P2RX7. Synthetic peptide located within the following region: VKEEIVENGVKKLVHSVFDTADYTFPLQGNSFFVMTNFLKTEGQEQRLCP |
Transient overexpression of P2RX7 (NM_002562) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Purified recombinant protein of Human purinergic receptor P2X, ligand-gated ion channel, 7 (P2RX7), transcript variant 1, Ser47-Val334, with N-terminal His tag, expressed in E.coli, 50ug
| Tag | N-His |
| Expression Host | E. coli |
Transient overexpression of P2RX7 (NM_002562) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of P2RX7 (NM_002562) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack
Active filters
Target Symbol
- P2RX7
Pathways
- Calcium signaling pathway