Germany
Japan
United Kingdom
China
CADM3 (Myc-DDK-tagged)-Human cell adhesion molecule 3 (CADM3), transcript variant 1
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
Products
View as table Download
Lenti ORF clone of Human cell adhesion molecule 3 (CADM3), transcript variant 1, Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, CADM3 (Myc-DDK tagged) - Human cell adhesion molecule 3 (CADM3), transcript variant 1, 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Human cell adhesion molecule 3 (CADM3), transcript variant 1, mGFP tagged
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, CADM3 (mGFP-tagged) - Human cell adhesion molecule 3 (CADM3), transcript variant 1, 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
CADM3 (Myc-DDK-tagged)-Human cell adhesion molecule 3 (CADM3), transcript variant 2
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti-ORF clone of CADM3 (Myc-DDK-tagged)-Human cell adhesion molecule 3 (CADM3), transcript variant 2
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, CADM3 (Myc-DDK-tagged)-Human cell adhesion molecule 3 (CADM3), transcript variant 2, 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti-ORF clone of CADM3 (mGFP-tagged)-Human cell adhesion molecule 3 (CADM3), transcript variant 2
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, CADM3 (mGFP-tagged)-Human cell adhesion molecule 3 (CADM3), transcript variant 2, 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
CADM3 (GFP-tagged) - Human cell adhesion molecule 3 (CADM3), transcript variant 1
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
CADM3 (GFP-tagged) - Human cell adhesion molecule 3 (CADM3), transcript variant 2
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
CADM3 (untagged)-Human cell adhesion molecule 3 (CADM3), transcript variant 1
| Vector | pCMV6-Entry |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
CADM3 (untagged)-Human cell adhesion molecule 3 (CADM3), transcript variant 2
| Vector | pCMV6-XL4 |
| Tag | Tag Free |
| Mammalian Cell Selection | None |
Rabbit polyclonal anti-CADM3 antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human CADM3. |
Rabbit Polyclonal Anti-CADM3 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CADM3 antibody: synthetic peptide directed towards the middle region of human CADM3. Synthetic peptide located within the following region: KDTATLNCQSSGSKPAARLTWRKGDQELHGEPTRIQEDPNGKTFTVSSSV |
CADM3 HEK293T cell transient overexpression lysate (as WB positive control)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Transient overexpression lysate of cell adhesion molecule 3 (CADM3), transcript variant 1
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
CADM3 MS Standard C13 and N15-labeled recombinant protein (NP_067012)
| Tag | C-Myc/DDK |
| Expression Host | HEK293 |
Transient overexpression of CADM3 (NM_021189) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of CADM3 (NM_001127173) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Recombinant protein of human cell adhesion molecule 3 (CADM3), transcript variant 2
| Tag | C-His |
| Expression Host | HEK293 |
Recombinant protein of human cell adhesion molecule 3 (CADM3), transcript variant 2
| Tag | C-His |
| Expression Host | HEK293 |
Recombinant protein of human cell adhesion molecule 3 (CADM3), transcript variant 2
| Tag | C-His |
| Expression Host | HEK293 |
Recombinant protein of human cell adhesion molecule 3 (CADM3), transcript variant 2
| Tag | C-His |
| Expression Host | HEK293 |
Transient overexpression of CADM3 (NM_021189) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of CADM3 (NM_021189) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack
Transient overexpression of CADM3 (NM_001127173) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack
Active filters
Target Symbol
- CADM3
Pathways
- Cell adhesion molecules (CAMs)