Products

cDNA Clones (20)
Proteins (13)
Antibodies (10)
Jump to Filters
View as table Download
CDK6 (NM_001259) Human Tagged ORF Clone
RC208560

USD 420.00

In Stock

CDK6 (Myc-DDK-tagged)-Human cyclin-dependent kinase 6 (CDK6), transcript variant 1

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
CDK6 (NM_001145306) Human Tagged ORF Clone
RC227978

USD 420.00

In Stock

CDK6 (Myc-DDK-tagged)-Human cyclin-dependent kinase 6 (CDK6), transcript variant 2

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
CDK6 (NM_001259) Human Untagged Clone
SC119341

USD 310.00

In Stock

CDK6 (untagged)-Human cyclin-dependent kinase 6 (CDK6), transcript variant 1

Vector pCMV6-XL4
Tag Tag Free
Mammalian Cell Selection None
CDK6 (NM_001259) Human Tagged ORF Clone Lentiviral Particle
RC208560L1V

USD 820.00

3 Weeks

Lenti ORF particles, CDK6 (Myc-DDK tagged) - Human cyclin-dependent kinase 6 (CDK6), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
  • LentiORF®
CDK6 (NM_001259) Human Tagged ORF Clone Lentiviral Particle
RC208560L2V

USD 820.00

6 Weeks

Lenti ORF particles, CDK6 (mGFP-tagged) - Human cyclin-dependent kinase 6 (CDK6), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP
Tag mGFP
  • LentiORF®
CDK6 (NM_001259) Human Tagged ORF Clone
RG208560

USD 460.00

In Stock

CDK6 (GFP-tagged) - Human cyclin-dependent kinase 6 (CDK6), transcript variant 1

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
CDK6 (NM_001259) Human Tagged ORF Clone Lentiviral Particle
RC208560L3V

USD 820.00

5 Weeks

Lenti ORF particles, CDK6 (Myc-DDK tagged) - Human cyclin-dependent kinase 6 (CDK6), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
CDK6 (NM_001259) Human Tagged ORF Clone
RC208560L4

USD 620.00

In Stock

Lenti ORF clone of Human cyclin-dependent kinase 6 (CDK6), transcript variant 1, mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
CDK6 (NM_001259) Human Tagged ORF Clone Lentiviral Particle
RC208560L4V

USD 820.00

3 Weeks

Lenti ORF particles, CDK6 (mGFP-tagged) - Human cyclin-dependent kinase 6 (CDK6), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
CDK6 (NM_001145306) Human Tagged ORF Clone
RC227978L3

USD 620.00

3 Weeks

Lenti ORF clone of Human cyclin-dependent kinase 6 (CDK6), transcript variant 2, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
CDK6 (NM_001145306) Human Tagged ORF Clone Lentiviral Particle
RC227978L3V

USD 820.00

6 Weeks

Lenti ORF particles, CDK6 (Myc-DDK tagged) - Human cyclin-dependent kinase 6 (CDK6), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
CDK6 (NM_001145306) Human Tagged ORF Clone
RC227978L4

USD 620.00

3 Weeks

Lenti ORF clone of Human cyclin-dependent kinase 6 (CDK6), transcript variant 2, mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
CDK6 (NM_001145306) Human Tagged ORF Clone Lentiviral Particle
RC227978L4V

USD 820.00

6 Weeks

Lenti ORF particles, CDK6 (mGFP-tagged) - Human cyclin-dependent kinase 6 (CDK6), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
CDK6 (NM_001145306) Human Tagged ORF Clone
RG227978

USD 460.00

3 Weeks

CDK6 (GFP-tagged) - Human cyclin-dependent kinase 6 (CDK6), transcript variant 2

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
CDK6 (NM_001259) Human Tagged ORF Clone
RC208560L1

USD 768.00

In Stock

Lenti ORF clone of Human cyclin-dependent kinase 6 (CDK6), transcript variant 1, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
Mammalian Cell Selection None
  • LentiORF®
CDK6 Rabbit Polyclonal Antibody
TA333180

USD 352.00

3 Weeks

Phospho-CDK6-Y13 Rabbit Polyclonal Antibody

Applications ICC/IF, IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen A phospho specific peptide corresponding to residues surrounding Y13 of human CDK6
Modifications Phospho-specific
CDK6 Mouse Monoclonal Antibody [Clone ID: 8H4]
AM31156PU-N

USD 480.00

2 Weeks

CDK6 mouse monoclonal antibody, clone 8H4, Purified

Applications ELISA, IF, IHC, WB
Reactivities Human, Rat
CDK6 pTyr13 Rabbit Polyclonal Antibody
AP09488PU-N

USD 300.00

2 Weeks

CDK6 pTyr13 rabbit polyclonal antibody, Aff - Purified

Applications IF, IHC, WB
Reactivities Human, Mouse
Immunogen The antiserum was produced against synthesized phosphopeptide derived from Human CDK6 around the phosphorylation site of Tyrosine 13 (Q-Q-Yp-E-C).
CDK6 pTyr13 Rabbit Polyclonal Antibody
AP09488PU-S

USD 230.00

2 Weeks

CDK6 pTyr13 rabbit polyclonal antibody, Aff - Purified

Applications IF, IHC, WB
Reactivities Human, Mouse
Immunogen The antiserum was produced against synthesized phosphopeptide derived from Human CDK6 around the phosphorylation site of Tyrosine 13 (Q-Q-Yp-E-C).
CDK6 (NM_001259) Human Tagged ORF Clone
RC208560L2

USD 620.00

3 Weeks

Lenti ORF clone of Human cyclin-dependent kinase 6 (CDK6), transcript variant 1, mGFP tagged

Vector pLenti-C-mGFP
Tag mGFP
Mammalian Cell Selection None
  • LentiORF®
CDK6 (NM_001259) Human Untagged Clone
SC323496

USD 660.00

In Stock

CDK6 (untagged)-Kinase deficient mutant (K43M) of Human cyclin-dependent kinase 6 (CDK6)

Vector pCMV6-XL4
Tag Tag Free
Mammalian Cell Selection None
CDK6 Rabbit Polyclonal Antibody
TA323940

USD 345.00

4 Weeks

Anti-CDK6 (phospho-Tyr24) Rabbit Polyclonal Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Peptide sequence around phosphorylation site of tyrosine 24 (G-A-Y(p)-G-K) derived from Human CDK6.
Modifications Phospho-specific
CDK6 Mouse Monoclonal Antibody [Clone ID: IML-6]
AM20605PU-N

USD 405.00

2 Weeks

CDK6 mouse monoclonal antibody, clone IML-6, Purified

Applications IF, WB
Reactivities Human, Mouse, Rat
CDK6 (NM_001145306) Human Over-expression Lysate
LC428809

USD 121.00

In Stock

CDK6 HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
CDK6 (NM_001259) Human Over-expression Lysate
LY400506

USD 396.00

5 Days

Transient overexpression lysate of cyclin-dependent kinase 6 (CDK6), transcript variant 1

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
CDK6 Rabbit Polyclonal Antibody
TA323941

USD 345.00

4 Weeks

Anti-CDK6 Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Peptide sequence around aa.22~26 (G-A-Y-G-K) derived from Human CDK6.
CDK6 (NM_001145306) Human Over-expression Lysate
LY428809

USD 396.00

5 Days

Transient overexpression lysate of cyclin-dependent kinase 6 (CDK6), transcript variant 2

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
CDK6 Rabbit Polyclonal Antibody
TA330350

USD 310.00

5 Days

Rabbit Polyclonal Anti-CDK6 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CDK6 antibody: synthetic peptide directed towards the C terminal of human CDK6. Synthetic peptide located within the following region: LLKCLTFNPAKRISAYSALSHPYFQDLERCKENLDSHLPPSQNTSELNTA
CDK6 (NM_001259) Human Over-expression Lysate
LC400506

USD 121.00

2 Weeks

CDK6 HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
CDK6 (NM_001259) Human Mass Spec Standard
PH308560

USD 2,055.00

3 Weeks

CDK6 MS Standard C13 and N15-labeled recombinant protein (NP_001250)

Tag C-Myc/DDK
Expression Host HEK293
CDK6 (NM_001145306) Human Mass Spec Standard
PH327978

USD 2,055.00

3 Weeks

CDK6 MS Standard C13 and N15-labeled recombinant protein (NP_001138778)

Tag C-Myc/DDK
Expression Host HEK293
CDK6 (BC027989) Human Untagged Clone
SC123532

USD 960.00

2 Weeks

(untagged)-Homo sapiens, Similar to LOC168246, clone MGC:40162 IMAGE:4995539, complete cds

Vector pCMV6-XL5
Tag Tag Free
Mammalian Cell Selection None
CDK6 (NM_001145306) Human Untagged Clone
SC324946

USD 660.00

3 Weeks

CDK6 (untagged)-Human cyclin-dependent kinase 6 (CDK6), transcript variant 2

Vector pCMV6-Entry
Tag Tag Free
Mammalian Cell Selection Neomycin
CDK6 Rabbit Polyclonal Antibody
TA323938

USD 345.00

In Stock

Anti-CDK6 Rabbit Polyclonal Antibody

Applications ELISA, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein corresponding to a region derived from 13-300 amino acids of Human Cyclin-dependent kinase 6
CDK6 Rabbit Polyclonal Antibody
TA323939

USD 345.00

4 Weeks

Anti-CDK6 Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein corresponding to a region derived from 13-300 amino acids of human Cyclin-dependent kinase 6
CDK6 ICC Control Block
TB408560

USD 1,070.00

4 Weeks

Transient overexpression of CDK6 (NM_001259) in HEK293T cells paraffin embedded controls for ICC/IHC staining

CDK6 ICC Control Block
TB427978

USD 1,070.00

4 Weeks

Transient overexpression of CDK6 (NM_001145306) in HEK293T cells paraffin embedded controls for ICC/IHC staining

CDK6 Cytosection
TS408560

USD 225.00

4 Weeks

Transient overexpression of CDK6 (NM_001259) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack

CDK6 Cytosection
TS408560P5

USD 889.00

4 Weeks

Transient overexpression of CDK6 (NM_001259) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack

CDK6 Cytosection
TS427978

USD 225.00

4 Weeks

Transient overexpression of CDK6 (NM_001145306) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack

CDK6 Cytosection
TS427978P5

USD 889.00

4 Weeks

Transient overexpression of CDK6 (NM_001145306) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack