Products

View as table Download

E2F5 (Myc-DDK-tagged)-Human E2F transcription factor 5, p130-binding (E2F5), transcript variant 2

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin

E2F5 (Myc-DDK-tagged)-Human E2F transcription factor 5, p130-binding (E2F5), transcript variant 1

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®

E2F5 (GFP-tagged) - Human E2F transcription factor 5, p130-binding (E2F5), transcript variant 1

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®

Lenti ORF clone of Human E2F transcription factor 5, p130-binding (E2F5), transcript variant 2, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF particles, E2F5 (Myc-DDK tagged) - Human E2F transcription factor 5, p130-binding (E2F5), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF clone of Human E2F transcription factor 5, p130-binding (E2F5), transcript variant 2, mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF particles, E2F5 (mGFP-tagged) - Human E2F transcription factor 5, p130-binding (E2F5), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti-ORF clone of E2F5 (Myc-DDK-tagged)-Human E2F transcription factor 5, p130-binding (E2F5), transcript variant 1

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF particles, E2F5 (Myc-DDK-tagged)-Human E2F transcription factor 5, p130-binding (E2F5), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti-ORF clone of E2F5 (mGFP-tagged)-Human E2F transcription factor 5, p130-binding (E2F5), transcript variant 1

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF particles, E2F5 (mGFP-tagged)-Human E2F transcription factor 5, p130-binding (E2F5), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

E2F5 (Myc-DDK-tagged)-Human E2F transcription factor 5, p130-binding (E2F5), transcript variant 3

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®

Lenti-ORF clone of E2F5 (Myc-DDK-tagged)-Human E2F transcription factor 5, p130-binding (E2F5), transcript variant 3

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF particles, E2F5 (Myc-DDK-tagged)-Human E2F transcription factor 5, p130-binding (E2F5), transcript variant 3, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti-ORF clone of E2F5 (mGFP-tagged)-Human E2F transcription factor 5, p130-binding (E2F5), transcript variant 3

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF particles, E2F5 (mGFP-tagged)-Human E2F transcription factor 5, p130-binding (E2F5), transcript variant 3, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

E2F5 (GFP-tagged) - Human E2F transcription factor 5, p130-binding (E2F5), transcript variant 2

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®

E2F5 (GFP-tagged) - Human E2F transcription factor 5, p130-binding (E2F5), transcript variant 3

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®

E2F5 (untagged)-Human E2F transcription factor 5, p130-binding (E2F5), transcript variant 1

Vector pCMV6-XL4
Tag Tag Free
Mammalian Cell Selection None

Purified recombinant protein of Human E2F transcription factor 5, p130-binding (E2F5), transcript variant 1, with N-terminal HIS tag, expressed in E.Coli, 50ug

Tag N-His
Expression Host E. coli

E2F5 rabbit polyclonal antibody, Aff - Purified

Applications WB
Reactivities Human, Mouse, Rat

Rabbit Polyclonal Anti-E2F5 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-E2F5 antibody: synthetic peptide directed towards the N terminal of human E2F5. Synthetic peptide located within the following region: KAEIEDLELKERELDQQKLLLQQSIKNVMDDSINNRFSYVTHEDICNCFN

Rabbit anti E2F-5 Polyclonal Antibody

Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) E2F5 mouse monoclonal antibody,clone OTI1G9

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) E2F5 mouse monoclonal antibody,clone OTI3B7

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) E2F5 mouse monoclonal antibody,clone OTI1B8

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

E2F5 HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB

E2F5 HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB

Transient overexpression lysate of E2F transcription factor 5, p130-binding (E2F5), transcript variant 1

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB

Transient overexpression lysate of E2F transcription factor 5, p130-binding (E2F5), transcript variant 2

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB

E2F5 MS Standard C13 and N15-labeled recombinant protein (NP_001942)

Tag C-Myc/DDK
Expression Host HEK293

E2F5 (untagged)-Human E2F transcription factor 5, p130-binding (E2F5), transcript variant 3

Vector pCMV6 series
Tag Tag Free

E2F5 (untagged)-Human E2F transcription factor 5, p130-binding (E2F5), transcript variant 2

Vector pCMV6-Entry
Tag Tag Free
Mammalian Cell Selection Neomycin

E2F5 mouse monoclonal antibody,clone OTI1G9

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

E2F5 mouse monoclonal antibody,clone OTI1G9

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

E2F5 mouse monoclonal antibody,clone OTI3B7

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

E2F5 mouse monoclonal antibody,clone OTI3B7, Biotinylated

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Biotin

E2F5 mouse monoclonal antibody,clone OTI3B7, HRP conjugated

Applications WB
Reactivities Human, Mouse, Rat
Conjugation HRP

E2F5 mouse monoclonal antibody,clone OTI3B7

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

E2F5 mouse monoclonal antibody,clone OTI1B8

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

E2F5 mouse monoclonal antibody,clone OTI1B8, Biotinylated

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Biotin

E2F5 mouse monoclonal antibody,clone OTI1B8, HRP conjugated

Applications WB
Reactivities Human, Mouse, Rat
Conjugation HRP

E2F5 mouse monoclonal antibody,clone OTI1B8

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Transient overexpression of E2F5 (NM_001083588) in HEK293T cells paraffin embedded controls for ICC/IHC staining

Transient overexpression of E2F5 (NM_001951) in HEK293T cells paraffin embedded controls for ICC/IHC staining

Transient overexpression of E2F5 (NM_001083589) in HEK293T cells paraffin embedded controls for ICC/IHC staining

USD 225.00

4 Weeks

Transient overexpression of E2F5 (NM_001083588) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack

USD 889.00

4 Weeks

Transient overexpression of E2F5 (NM_001083588) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack