Germany
Japan
United Kingdom
China
MCM4 (Myc-DDK-tagged)-Human minichromosome maintenance complex component 4 (MCM4), transcript variant 2
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
Products
View as table Download
MCM4 (Myc-DDK-tagged)-Human minichromosome maintenance complex component 4 (MCM4), transcript variant 1
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
Lenti ORF particles, MCM4 (Myc-DDK tagged) - Human minichromosome maintenance complex component 4 (MCM4), transcript variant 2, 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
- LentiORF®
-
Lenti ORF particles, MCM4 (mGFP-tagged) - Human minichromosome maintenance complex component 4 (MCM4), transcript variant 2, 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
- LentiORF®
-
MCM4 (GFP-tagged) - Human minichromosome maintenance complex component 4 (MCM4), transcript variant 2
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Recombinant protein of human minichromosome maintenance complex component 4 (MCM4), transcript variant 2
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
Special Offer: Get a 20% discount on this product. Use code: "MVPro20".
MCM4 (GFP-tagged) - Human minichromosome maintenance complex component 4 (MCM4), transcript variant 1
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti ORF clone of Human minichromosome maintenance complex component 4 (MCM4), transcript variant 2, Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, MCM4 (Myc-DDK tagged) - Human minichromosome maintenance complex component 4 (MCM4), transcript variant 2, 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Human minichromosome maintenance complex component 4 (MCM4), transcript variant 2, mGFP tagged
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, MCM4 (mGFP-tagged) - Human minichromosome maintenance complex component 4 (MCM4), transcript variant 2, 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Human minichromosome maintenance complex component 4 (MCM4), transcript variant 1, Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, MCM4 (Myc-DDK tagged) - Human minichromosome maintenance complex component 4 (MCM4), transcript variant 1, 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Human minichromosome maintenance complex component 4 (MCM4), transcript variant 1, mGFP tagged
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, MCM4 (mGFP-tagged) - Human minichromosome maintenance complex component 4 (MCM4), transcript variant 1, 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
MCM4 (untagged)-Human minichromosome maintenance complex component 4 (MCM4), transcript variant 1
| Vector | pCMV6-XL5 |
| Tag | Tag Free |
| Mammalian Cell Selection | None |
Lenti ORF clone of Human minichromosome maintenance complex component 4 (MCM4), transcript variant 2, Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
| Mammalian Cell Selection | None |
- LentiORF®
MCM4 HEK293T cell transient overexpression lysate (as WB positive control)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Lenti ORF clone of Human minichromosome maintenance complex component 4 (MCM4), transcript variant 2, mGFP tagged
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
| Mammalian Cell Selection | None |
- LentiORF®
MCM4 HEK293T cell transient overexpression lysate (as WB positive control)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Transient overexpression lysate of minichromosome maintenance complex component 4 (MCM4), transcript variant 2
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Rabbit Polyclonal Anti-MCM4 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-MCM4 antibody: synthetic peptide directed towards the middle region of human MCM4. Synthetic peptide located within the following region: VYKTHIDVIHYRKTDAKRLHGLDEEAEQKLFSEKRVELLKELSRKPDIYE |
Rabbit Polyclonal Anti-MCM4 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-MCM4 antibody: synthetic peptide directed towards the N terminal of human MCM4. Synthetic peptide located within the following region: SRVEGTPRSGVRGTPVRQRPDLGSAQKGLQVDLQSDGAAAEDIVASEQSL |
Rabbit Polyclonal Anti-MCM4 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-MCM4 antibody: synthetic peptide directed towards the C terminal of human MCM4. Synthetic peptide located within the following region: KEELAEALKKLILSKGKTPALKYQQLFEDIRGQSDIAITKDMFEEALRAL |
Transient overexpression lysate of minichromosome maintenance complex component 4 (MCM4), transcript variant 1
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
MCM4 MS Standard C13 and N15-labeled recombinant protein (NP_877423)
| Tag | C-Myc/DDK |
| Expression Host | HEK293 |
MCM4 MS Standard C13 and N15-labeled recombinant protein (NP_005905)
| Tag | C-Myc/DDK |
| Expression Host | HEK293 |
MCM4 (untagged)-Human minichromosome maintenance complex component 4 (MCM4), transcript variant 2
| Vector | pCMV6-XL4 |
| Tag | Tag Free |
| Mammalian Cell Selection | None |
Anti-MCM4 Rabbit Polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region derived from 837-850 amino acids of Human minichromosome maintenance complex component 4 |
Transient overexpression of MCM4 (NM_182746) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of MCM4 (NM_005914) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of MCM4 (NM_182746) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of MCM4 (NM_182746) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack
Transient overexpression of MCM4 (NM_005914) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of MCM4 (NM_005914) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack
Active filters
Target Symbol
- MCM4
Pathways
- Cell cycle