Germany
Japan
United Kingdom
China
JAK3 (Myc-DDK-tagged)-Human Janus kinase 3 (JAK3)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
Products
View as table Download
Lenti ORF particles, JAK3 (Myc-DDK tagged) - Human Janus kinase 3 (JAK3), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
- LentiORF®
-
Lenti ORF particles, JAK3 (mGFP-tagged) - Human Janus kinase 3 (JAK3), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
- LentiORF®
-
JAK3 (GFP-tagged) - Human Janus kinase 3 (JAK3)
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti ORF particles, JAK3 (Myc-DDK tagged) - Human Janus kinase 3 (JAK3), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Human Janus kinase 3 (JAK3), mGFP tagged
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, JAK3 (mGFP-tagged) - Human Janus kinase 3 (JAK3), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Human Janus kinase 3 (JAK3), mGFP tagged
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
| Mammalian Cell Selection | None |
- LentiORF®
JAK3 (untagged)-Human Janus kinase 3 (JAK3)
| Vector | pCMV6-XL5 |
| Tag | Tag Free |
| Mammalian Cell Selection | None |
SC311134 is the updated version of SC125449.
Transient overexpression lysate of Janus kinase 3 (JAK3)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Lenti ORF clone of Human Janus kinase 3 (JAK3), Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
JAK3 HEK293T cell transient overexpression lysate (as WB positive control)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Lenti ORF clone of Human Janus kinase 3 (JAK3), Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
| Mammalian Cell Selection | None |
- LentiORF®
JAK3 MS Standard C13 and N15-labeled recombinant protein (NP_000206)
| Tag | C-Myc/DDK |
| Expression Host | HEK293 |
Rabbit Polyclonal Anti-JAK3 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-JAK3 Antibody is: synthetic peptide directed towards the N-terminal region of Human JAK3. Synthetic peptide located within the following region: APPSEETPLIPQRSCSLLSTEAGALHVLLPARGPGPPQRLSFSFGDHLAE |
Rabbit Polyclonal Anti-JAK3 Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-JAK3 Antibody: synthetic peptide directed towards the middle region of human JAK3. Synthetic peptide located within the following region: KLLPLDKDYYVVREPGQSPIFWYAPESLSDNIFSRQSDVWSFGVVLYELF |
Rabbit anti JAK3 Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide derived from the adjacent to C-terminus of JAK3 protein. This sequence is identical in JAK3 from human, rat and mouse origins. |
Carrier-free (BSA/glycerol-free) JAK3 mouse monoclonal antibody,clone OTI1B4
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) JAK3 mouse monoclonal antibody,clone OTI2B4
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
JAK3 mouse monoclonal antibody,clone OTI1B4
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
JAK3 mouse monoclonal antibody,clone OTI1B4, Biotinylated
| Applications | WB |
| Reactivities | Human |
| Conjugation | Biotin |
JAK3 mouse monoclonal antibody,clone OTI1B4, HRP conjugated
| Applications | WB |
| Reactivities | Human |
| Conjugation | HRP |
JAK3 mouse monoclonal antibody,clone OTI1B4
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
JAK3 mouse monoclonal antibody,clone OTI2B4
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
JAK3 mouse monoclonal antibody,clone OTI2B4, Biotinylated
| Applications | WB |
| Reactivities | Human |
| Conjugation | Biotin |
JAK3 mouse monoclonal antibody,clone OTI2B4, HRP conjugated
| Applications | WB |
| Reactivities | Human |
| Conjugation | HRP |
JAK3 mouse monoclonal antibody,clone OTI2B4
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Transient overexpression of JAK3 (NM_000215) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of JAK3 (NM_000215) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of JAK3 (NM_000215) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack
Active filters
Target Symbol
- JAK3
Pathways
- Chemokine signaling pathway