PDHA2 (Myc-DDK-tagged)-Human pyruvate dehydrogenase (lipoamide) alpha 2 (PDHA2)
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
PDHA2 (Myc-DDK-tagged)-Human pyruvate dehydrogenase (lipoamide) alpha 2 (PDHA2)
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
Recombinant protein of human pyruvate dehydrogenase (lipoamide) alpha 2 (PDHA2)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Special Offer: Get a 20% discount on this product. Use code: "MVPro20".
PDHA2 (GFP-tagged) - Human pyruvate dehydrogenase (lipoamide) alpha 2 (PDHA2)
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
Lenti ORF clone of Human pyruvate dehydrogenase (lipoamide) alpha 2 (PDHA2), Myc-DDK-tagged
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, PDHA2 (Myc-DDK tagged) - Human pyruvate dehydrogenase (lipoamide) alpha 2 (PDHA2), 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF clone of Human pyruvate dehydrogenase (lipoamide) alpha 2 (PDHA2), mGFP tagged
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, PDHA2 (mGFP-tagged) - Human pyruvate dehydrogenase (lipoamide) alpha 2 (PDHA2), 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
PDHA2 (Center) rabbit polyclonal antibody, Aff - Purified
Applications | IHC, WB |
Reactivities | Human |
Immunogen | KLH conjugated synthetic peptide between 290-318 amino acids from the Central region of Human PDHA2 |
Transient overexpression lysate of pyruvate dehydrogenase (lipoamide) alpha 2 (PDHA2)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
Rabbit Polyclonal Anti-PDHA2 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-PDHA2 Antibody: synthetic peptide directed towards the N terminal of human PDHA2. Synthetic peptide located within the following region: RMELKADQLYKQKFIRGFCHLCDGQEACCVGLEAGINPSDHVITSYRAHG |
PDHA2 HEK293T cell transient overexpression lysate (as WB positive control)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
PDHA2 MS Standard C13 and N15-labeled recombinant protein (NP_005381)
Tag | C-Myc/DDK |
Expression Host | HEK293 |
PDHA2 (untagged)-Human pyruvate dehydrogenase (lipoamide) alpha 2 (PDHA2)
Vector | pCMV6-Entry |
Tag | Tag Free |
Mammalian Cell Selection | Neomycin |
Transient overexpression of PDHA2 (NM_005390) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of PDHA2 (NM_005390) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of PDHA2 (NM_005390) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack