CTH (Myc-DDK-tagged)-Human cystathionase (cystathionine gamma-lyase) (CTH), transcript variant 3
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
CTH (Myc-DDK-tagged)-Human cystathionase (cystathionine gamma-lyase) (CTH), transcript variant 3
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
CTH (Myc-DDK-tagged)-Human cystathionase (cystathionine gamma-lyase) (CTH), transcript variant 1
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
Recombinant protein of human cystathionase (cystathionine gamma-lyase) (CTH), transcript variant 1
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Special Offer: Get a 20% discount on this product. Use code: "MVPro20".
USD 820.00
3 Weeks
Lenti ORF particles, CTH (Myc-DDK tagged) - Human cystathionase (cystathionine gamma-lyase) (CTH), transcript variant 1, 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK |
Tag | Myc-DDK |
USD 820.00
6 Weeks
Lenti ORF particles, CTH (mGFP-tagged) - Human cystathionase (cystathionine gamma-lyase) (CTH), transcript variant 1, 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP |
Tag | mGFP |
CTH (GFP-tagged) - Human cystathionase (cystathionine gamma-lyase) (CTH), transcript variant 1
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
CTH (Myc-DDK-tagged)-Human cystathionase (cystathionine gamma-lyase) (CTH), transcript variant 2
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
Lenti ORF clone of Human cystathionase (cystathionine gamma-lyase) (CTH), transcript variant 1, Myc-DDK-tagged
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
USD 820.00
5 Weeks
Lenti ORF particles, CTH (Myc-DDK tagged) - Human cystathionase (cystathionine gamma-lyase) (CTH), transcript variant 1, 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF clone of Human cystathionase (cystathionine gamma-lyase) (CTH), transcript variant 1, mGFP tagged
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
USD 820.00
7 Weeks
Lenti ORF particles, CTH (mGFP-tagged) - Human cystathionase (cystathionine gamma-lyase) (CTH), transcript variant 1, 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Lenti ORF clone of Human cystathionase (cystathionine gamma-lyase) (CTH), transcript variant 2, Myc-DDK-tagged
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
USD 820.00
6 Weeks
Lenti ORF particles, CTH (Myc-DDK tagged) - Human cystathionase (cystathionine gamma-lyase) (CTH), transcript variant 2, 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF clone of Human cystathionase (cystathionine gamma-lyase) (CTH), transcript variant 2, mGFP tagged
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
USD 820.00
6 Weeks
Lenti ORF particles, CTH (mGFP-tagged) - Human cystathionase (cystathionine gamma-lyase) (CTH), transcript variant 2, 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Lenti ORF clone of Human cystathionase (cystathionine gamma-lyase) (CTH), transcript variant 3, Myc-DDK-tagged
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
USD 820.00
6 Weeks
Lenti ORF particles, CTH (Myc-DDK tagged) - Human cystathionase (cystathionine gamma-lyase) (CTH), transcript variant 3, 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF clone of Human cystathionase (cystathionine gamma-lyase) (CTH), transcript variant 3, mGFP tagged
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
USD 820.00
6 Weeks
Lenti ORF particles, CTH (mGFP-tagged) - Human cystathionase (cystathionine gamma-lyase) (CTH), transcript variant 3, 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
CTH (GFP-tagged) - Human cystathionase (cystathionine gamma-lyase) (CTH), transcript variant 2
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
CTH (GFP-tagged) - Human cystathionase (cystathionine gamma-lyase) (CTH), transcript variant 3
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
Lenti ORF clone of Human cystathionase (cystathionine gamma-lyase) (CTH), transcript variant 1, Myc-DDK-tagged
Vector | pLenti-C-Myc-DDK |
Tag | Myc-DDK |
Mammalian Cell Selection | None |
CTH HEK293T cell transient overexpression lysate (as WB positive control)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
Transient overexpression lysate of cystathionase (cystathionine gamma-lyase) (CTH), transcript variant 1
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
Lenti ORF clone of Human cystathionase (cystathionine gamma-lyase) (CTH), transcript variant 1, mGFP tagged
Vector | pLenti-C-mGFP |
Tag | mGFP |
Mammalian Cell Selection | None |
Rabbit Polyclonal Anti-CTH Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-CTH antibody: synthetic peptide directed towards the C terminal of human CTH. Synthetic peptide located within the following region: ESNPWVEKVIYPGLPSHPQHELVKRQCTGCTGMVTFYIKGTLQHAEIFLK |
Rabbit Polyclonal Anti-CTH Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-CTH antibody: synthetic peptide directed towards the N terminal of human CTH. Synthetic peptide located within the following region: VPPISLSTTFKQGAPGQHSGFEYSRSGNPTRNCLEKAVAALDGAKYCLAF |
CTH (untagged)-Human cystathionase (cystathionine gamma-lyase) (CTH), transcript variant 1
Vector | pCMV6-XL5 |
Tag | Tag Free |
Mammalian Cell Selection | None |
CTH (1-405, His-tag) human recombinant protein, 0.5 mg
Tag | His-tag |
Expression Host | E. coli |
CTH (1-405, His-tag) human recombinant protein, 0.1 mg
Tag | His-tag |
Expression Host | E. coli |
Carrier-free (BSA/glycerol-free) CTH mouse monoclonal antibody, clone OTI1E12 (formerly 1E12)
Applications | IHC, WB |
Reactivities | Human, Monkey, Mouse, Dog |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) CTH mouse monoclonal antibody, clone OTI2D6 (formerly 2D6)
Applications | IHC, WB |
Reactivities | Human, Monkey, Mouse, Dog |
Conjugation | Unconjugated |
CTH HEK293T cell transient overexpression lysate (as WB positive control)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
Transient overexpression lysate of cystathionase (cystathionine gamma-lyase) (CTH), transcript variant 3
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
CTH MS Standard C13 and N15-labeled recombinant protein (NP_001893)
Tag | C-Myc/DDK |
Expression Host | HEK293 |
CTH (untagged)-Human cystathionase (cystathionine gamma-lyase) (CTH), transcript variant 2
Vector | pCMV6-Entry |
Tag | Tag Free |
Mammalian Cell Selection | Neomycin |
CTH (Cystathionase) mouse monoclonal antibody, clone OTI1E12 (formerly 1E12)
Applications | IHC, WB |
Reactivities | Human, Monkey, Mouse, Dog |
Conjugation | Unconjugated |
USD 420.00
4 Weeks
CTH (Cystathionase) mouse monoclonal antibody, clone OTI1E12 (formerly 1E12), Biotinylated
Applications | IHC, WB |
Reactivities | Human, Monkey, Mouse, Dog |
Conjugation | Biotin |
USD 420.00
4 Weeks
CTH (Cystathionase) mouse monoclonal antibody, clone OTI1E12 (formerly 1E12), HRP conjugated
Applications | IHC, WB |
Reactivities | Human, Monkey, Mouse, Dog |
Conjugation | HRP |
CTH (Cystathionase) mouse monoclonal antibody, clone OTI1E12 (formerly 1E12)
Applications | IHC, WB |
Reactivities | Human, Monkey, Mouse, Dog |
Conjugation | Unconjugated |
CTH (Cystathionase) mouse monoclonal antibody, clone OTI2D6 (formerly 2D6)
Applications | IHC, WB |
Reactivities | Human, Monkey, Mouse, Dog |
Conjugation | Unconjugated |
USD 420.00
4 Weeks
CTH (Cystathionase) mouse monoclonal antibody, clone OTI2D6 (formerly 2D6), Biotinylated
Applications | IHC, WB |
Reactivities | Human, Monkey, Mouse, Dog |
Conjugation | Biotin |
USD 420.00
4 Weeks
CTH (Cystathionase) mouse monoclonal antibody, clone OTI2D6 (formerly 2D6), HRP conjugated
Applications | IHC, WB |
Reactivities | Human, Monkey, Mouse, Dog |
Conjugation | HRP |
CTH (Cystathionase) mouse monoclonal antibody, clone OTI2D6 (formerly 2D6)
Applications | IHC, WB |
Reactivities | Human, Monkey, Mouse, Dog |
Conjugation | Unconjugated |
Transient overexpression of CTH (NM_001902) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of CTH (NM_153742) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of CTH (NM_001190463) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Purified recombinant protein of Human cystathionase (cystathionine gamma-lyase) (CTH), transcript variant 1
Tag | tag free |
Expression Host | E. coli |
Purified recombinant protein of Human cystathionase (cystathionine gamma-lyase) (CTH), transcript variant 1
Tag | tag free |
Expression Host | E. coli |
Purified recombinant protein of Human cystathionase (cystathionine gamma-lyase) (CTH), transcript variant 1
Tag | tag free |
Expression Host | E. coli |