Products

cDNA Clones (24)
Proteins (21)
Antibodies (12)
Jump to Filters
View as table Download
Cystathionase (CTH) (NM_001190463) Human Tagged ORF Clone
RC231191

USD 98.00

USD 460.00

In Stock

CTH (Myc-DDK-tagged)-Human cystathionase (cystathionine gamma-lyase) (CTH), transcript variant 3

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
Cystathionase (CTH) (NM_001902) Human Tagged ORF Clone
RC202195

USD 420.00

In Stock

CTH (Myc-DDK-tagged)-Human cystathionase (cystathionine gamma-lyase) (CTH), transcript variant 1

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
Cystathionase (CTH) (NM_001902) Human Tagged ORF Clone
RG202195

USD 460.00

In Stock

CTH (GFP-tagged) - Human cystathionase (cystathionine gamma-lyase) (CTH), transcript variant 1

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
Cystathionase (CTH) (NM_153742) Human Tagged ORF Clone
RC214774

USD 420.00

In Stock

CTH (Myc-DDK-tagged)-Human cystathionase (cystathionine gamma-lyase) (CTH), transcript variant 2

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
Cystathionase (CTH) (NM_001902) Human Tagged ORF Clone
RC202195L3

USD 620.00

3 Weeks

Lenti ORF clone of Human cystathionase (cystathionine gamma-lyase) (CTH), transcript variant 1, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Cystathionase (CTH) (NM_001902) Human Tagged ORF Clone Lentiviral Particle
RC202195L3V

USD 820.00

5 Weeks

Lenti ORF particles, CTH (Myc-DDK tagged) - Human cystathionase (cystathionine gamma-lyase) (CTH), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Cystathionase (CTH) (NM_001902) Human Tagged ORF Clone
RC202195L4

USD 620.00

3 Weeks

Lenti ORF clone of Human cystathionase (cystathionine gamma-lyase) (CTH), transcript variant 1, mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
Cystathionase (CTH) (NM_001902) Human Tagged ORF Clone Lentiviral Particle
RC202195L4V

USD 820.00

7 Weeks

Lenti ORF particles, CTH (mGFP-tagged) - Human cystathionase (cystathionine gamma-lyase) (CTH), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
Cystathionase (CTH) (NM_153742) Human Tagged ORF Clone
RC214774L3

USD 620.00

3 Weeks

Lenti ORF clone of Human cystathionase (cystathionine gamma-lyase) (CTH), transcript variant 2, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Cystathionase (CTH) (NM_153742) Human Tagged ORF Clone Lentiviral Particle
RC214774L3V

USD 820.00

6 Weeks

Lenti ORF particles, CTH (Myc-DDK tagged) - Human cystathionase (cystathionine gamma-lyase) (CTH), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Cystathionase (CTH) (NM_153742) Human Tagged ORF Clone
RC214774L4

USD 620.00

3 Weeks

Lenti ORF clone of Human cystathionase (cystathionine gamma-lyase) (CTH), transcript variant 2, mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
Cystathionase (CTH) (NM_153742) Human Tagged ORF Clone Lentiviral Particle
RC214774L4V

USD 820.00

6 Weeks

Lenti ORF particles, CTH (mGFP-tagged) - Human cystathionase (cystathionine gamma-lyase) (CTH), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
Cystathionase (CTH) (NM_001190463) Human Tagged ORF Clone
RC231191L3

USD 620.00

3 Weeks

Lenti ORF clone of Human cystathionase (cystathionine gamma-lyase) (CTH), transcript variant 3, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Cystathionase (CTH) (NM_001190463) Human Tagged ORF Clone Lentiviral Particle
RC231191L3V

USD 820.00

6 Weeks

Lenti ORF particles, CTH (Myc-DDK tagged) - Human cystathionase (cystathionine gamma-lyase) (CTH), transcript variant 3, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Cystathionase (CTH) (NM_001190463) Human Tagged ORF Clone
RC231191L4

USD 620.00

3 Weeks

Lenti ORF clone of Human cystathionase (cystathionine gamma-lyase) (CTH), transcript variant 3, mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
Cystathionase (CTH) (NM_001190463) Human Tagged ORF Clone Lentiviral Particle
RC231191L4V

USD 820.00

6 Weeks

Lenti ORF particles, CTH (mGFP-tagged) - Human cystathionase (cystathionine gamma-lyase) (CTH), transcript variant 3, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
Cystathionase (CTH) (NM_153742) Human Tagged ORF Clone
RG214774

USD 460.00

3 Weeks

CTH (GFP-tagged) - Human cystathionase (cystathionine gamma-lyase) (CTH), transcript variant 2

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
Cystathionase (CTH) (NM_001190463) Human Tagged ORF Clone
RG231191

USD 460.00

3 Weeks

CTH (GFP-tagged) - Human cystathionase (cystathionine gamma-lyase) (CTH), transcript variant 3

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
Cystathionase (CTH) (NM_001902) Human Tagged ORF Clone
RC202195L1

USD 768.00

In Stock

Lenti ORF clone of Human cystathionase (cystathionine gamma-lyase) (CTH), transcript variant 1, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
Mammalian Cell Selection None
  • LentiORF®
Cystathionase (CTH) (NM_001902) Human Over-expression Lysate
LC419669

USD 121.00

In Stock

CTH HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
Cystathionase (CTH) (NM_001902) Human Over-expression Lysate
LY419669

USD 396.00

5 Days

Transient overexpression lysate of cystathionase (cystathionine gamma-lyase) (CTH), transcript variant 1

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
Cystathionase (CTH) (NM_001902) Human Tagged ORF Clone
RC202195L2

USD 620.00

3 Weeks

Lenti ORF clone of Human cystathionase (cystathionine gamma-lyase) (CTH), transcript variant 1, mGFP tagged

Vector pLenti-C-mGFP
Tag mGFP
Mammalian Cell Selection None
  • LentiORF®
Cystathionase (CTH) Rabbit Polyclonal Antibody
TA339248

USD 310.00

5 Days

Rabbit Polyclonal Anti-CTH Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CTH antibody: synthetic peptide directed towards the C terminal of human CTH. Synthetic peptide located within the following region: ESNPWVEKVIYPGLPSHPQHELVKRQCTGCTGMVTFYIKGTLQHAEIFLK
Cystathionase (CTH) Rabbit Polyclonal Antibody
TA339247

USD 375.00

5 Days

Rabbit Polyclonal Anti-CTH Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CTH antibody: synthetic peptide directed towards the N terminal of human CTH. Synthetic peptide located within the following region: VPPISLSTTFKQGAPGQHSGFEYSRSGNPTRNCLEKAVAALDGAKYCLAF
Cystathionase (CTH) (NM_001902) Human Untagged Clone
SC122611

USD 760.00

2 Weeks

CTH (untagged)-Human cystathionase (cystathionine gamma-lyase) (CTH), transcript variant 1

Vector pCMV6-XL5
Tag Tag Free
Mammalian Cell Selection None
CTH (1-405, His-tag) Human Protein
AR50158PU-N

USD 845.00

2 Weeks

CTH (1-405, His-tag) human recombinant protein, 0.5 mg

Tag His-tag
Expression Host E. coli
CTH (1-405, His-tag) Human Protein
AR50158PU-S

USD 330.00

2 Weeks

CTH (1-405, His-tag) human recombinant protein, 0.1 mg

Tag His-tag
Expression Host E. coli
Cystathionase (CTH) Mouse Monoclonal Antibody [Clone ID: OTI1E12]
CF502442

USD 465.00

4 Weeks

Carrier-free (BSA/glycerol-free) CTH mouse monoclonal antibody, clone OTI1E12 (formerly 1E12)

Applications IHC, WB
Reactivities Human, Monkey, Mouse, Dog
Conjugation Unconjugated
Cystathionase (CTH) Mouse Monoclonal Antibody [Clone ID: OTI2D6]
CF502443

USD 465.00

4 Weeks

Carrier-free (BSA/glycerol-free) CTH mouse monoclonal antibody, clone OTI2D6 (formerly 2D6)

Applications IHC, WB
Reactivities Human, Monkey, Mouse, Dog
Conjugation Unconjugated
Cystathionase (CTH) (NM_001190463) Human Over-expression Lysate
LC434190

USD 121.00

2 Weeks

CTH HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
Cystathionase (CTH) (NM_001190463) Human Over-expression Lysate
LY434190

USD 396.00

5 Days

Transient overexpression lysate of cystathionase (cystathionine gamma-lyase) (CTH), transcript variant 3

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
Cystathionase (CTH) (NM_001902) Human Mass Spec Standard
PH302195

USD 2,055.00

3 Weeks

CTH MS Standard C13 and N15-labeled recombinant protein (NP_001893)

Tag C-Myc/DDK
Expression Host HEK293
Cystathionase (CTH) (NM_153742) Human Untagged Clone
SC306651

USD 610.00

3 Weeks

CTH (untagged)-Human cystathionase (cystathionine gamma-lyase) (CTH), transcript variant 2

Vector pCMV6-Entry
Tag Tag Free
Mammalian Cell Selection Neomycin
Cystathionase (CTH) Mouse Monoclonal Antibody [Clone ID: OTI1E12]
TA502442

USD 379.00

In Stock

CTH (Cystathionase) mouse monoclonal antibody, clone OTI1E12 (formerly 1E12)

Applications IHC, WB
Reactivities Human, Monkey, Mouse, Dog
Conjugation Unconjugated
Cystathionase (CTH) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI1E12]
TA502442AM

USD 420.00

4 Weeks

CTH (Cystathionase) mouse monoclonal antibody, clone OTI1E12 (formerly 1E12), Biotinylated

Applications IHC, WB
Reactivities Human, Monkey, Mouse, Dog
Conjugation Biotin
Cystathionase (CTH) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI1E12]
TA502442BM

USD 420.00

4 Weeks

CTH (Cystathionase) mouse monoclonal antibody, clone OTI1E12 (formerly 1E12), HRP conjugated

Applications IHC, WB
Reactivities Human, Monkey, Mouse, Dog
Conjugation HRP
Cystathionase (CTH) Mouse Monoclonal Antibody [Clone ID: OTI1E12]
TA502442S

USD 159.00

2 Days

CTH (Cystathionase) mouse monoclonal antibody, clone OTI1E12 (formerly 1E12)

Applications IHC, WB
Reactivities Human, Monkey, Mouse, Dog
Conjugation Unconjugated
Cystathionase (CTH) Mouse Monoclonal Antibody [Clone ID: OTI2D6]
TA502443

USD 379.00

In Stock

CTH (Cystathionase) mouse monoclonal antibody, clone OTI2D6 (formerly 2D6)

Applications IHC, WB
Reactivities Human, Monkey, Mouse, Dog
Conjugation Unconjugated
Cystathionase (CTH) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI2D6]
TA502443AM

USD 420.00

4 Weeks

CTH (Cystathionase) mouse monoclonal antibody, clone OTI2D6 (formerly 2D6), Biotinylated

Applications IHC, WB
Reactivities Human, Monkey, Mouse, Dog
Conjugation Biotin
Cystathionase (CTH) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI2D6]
TA502443BM

USD 420.00

4 Weeks

CTH (Cystathionase) mouse monoclonal antibody, clone OTI2D6 (formerly 2D6), HRP conjugated

Applications IHC, WB
Reactivities Human, Monkey, Mouse, Dog
Conjugation HRP
Cystathionase (CTH) Mouse Monoclonal Antibody [Clone ID: OTI2D6]
TA502443S

USD 159.00

2 Days

CTH (Cystathionase) mouse monoclonal antibody, clone OTI2D6 (formerly 2D6)

Applications IHC, WB
Reactivities Human, Monkey, Mouse, Dog
Conjugation Unconjugated
Cystathionase (CTH) ICC Control Block
TB402195

USD 1,070.00

4 Weeks

Transient overexpression of CTH (NM_001902) in HEK293T cells paraffin embedded controls for ICC/IHC staining

Cystathionase (CTH) ICC Control Block
TB414774

USD 1,070.00

4 Weeks

Transient overexpression of CTH (NM_153742) in HEK293T cells paraffin embedded controls for ICC/IHC staining

Cystathionase (CTH) ICC Control Block
TB431191

USD 1,110.00

4 Weeks

Transient overexpression of CTH (NM_001190463) in HEK293T cells paraffin embedded controls for ICC/IHC staining

Cystathionase (CTH) (NM_001902) Human Recombinant Protein
TP720917

USD 330.00

3 Weeks

Purified recombinant protein of Human cystathionase (cystathionine gamma-lyase) (CTH), transcript variant 1

Tag tag free
Expression Host E. coli
Cystathionase (CTH) (NM_001902) Human Recombinant Protein
TP720917L

USD 1,900.00

3 Weeks

Purified recombinant protein of Human cystathionase (cystathionine gamma-lyase) (CTH), transcript variant 1

Tag tag free
Expression Host E. coli
Cystathionase (CTH) (NM_001902) Human Recombinant Protein
TP720917M

USD 760.00

3 Weeks

Purified recombinant protein of Human cystathionase (cystathionine gamma-lyase) (CTH), transcript variant 1

Tag tag free
Expression Host E. coli