MAT1A (Myc-DDK-tagged)-Human methionine adenosyltransferase I, alpha (MAT1A)
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
MAT1A (Myc-DDK-tagged)-Human methionine adenosyltransferase I, alpha (MAT1A)
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
Recombinant protein of human methionine adenosyltransferase I, alpha (MAT1A)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Special Offer: Get a 20% discount on this product. Use code: "MVPro20".
MAT1A (GFP-tagged) - Human methionine adenosyltransferase I, alpha (MAT1A)
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
Lenti ORF clone of Human methionine adenosyltransferase I, alpha (MAT1A), Myc-DDK-tagged
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, MAT1A (Myc-DDK tagged) - Human methionine adenosyltransferase I, alpha (MAT1A), 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF clone of Human methionine adenosyltransferase I, alpha (MAT1A), mGFP tagged
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, MAT1A (mGFP-tagged) - Human methionine adenosyltransferase I, alpha (MAT1A), 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
MAT1A (untagged)-Human methionine adenosyltransferase I, alpha (MAT1A)
Vector | pCMV6-XL4 |
Tag | Tag Free |
Mammalian Cell Selection | None |
Rabbit Polyclonal Anti-MAT1A Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-MAT1A antibody: synthetic peptide directed towards the N terminal of human MAT1A. Synthetic peptide located within the following region: TSESVGEGHPDKICDQISDAVLDAHLKQDPNAKVACETVCKTGMVLLCGE |
Rabbit Polyclonal Anti-MAT1A Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-MAT1A antibody: synthetic peptide directed towards the C terminal of human MAT1A. Synthetic peptide located within the following region: VAKSLVKAGLCRRVLVQVSYAIGVAEPLSISIFTYGTSQKTERELLDVVH |
MAT1A (N-term) rabbit polyclonal antibody, Aff - Purified
Applications | IHC, WB |
Reactivities | Human |
Immunogen | KLH conjugated synthetic peptide between 114-144 amino acids from the N-terminal region of human MAT1A |
MAT1A HEK293T cell transient overexpression lysate (as WB positive control)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Transient overexpression lysate of methionine adenosyltransferase I, alpha (MAT1A)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
MAT1A (1-395, His-tag) human recombinant protein, 0.25 mg
Tag | His-tag |
Expression Host | E. coli |
MAT1A (1-395, His-tag) human recombinant protein, 50 µg
Tag | His-tag |
Expression Host | E. coli |
MAT1A MS Standard C13 and N15-labeled recombinant protein (NP_000420)
Tag | C-Myc/DDK |
Expression Host | HEK293 |
Anti-MAT1A Rabbit Polyclonal Antibody
Applications | ELISA, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein corresponding to a region derived from 16-394 amino acids of human methionine adenosyltransferase I, alpha |
Anti-MAT1A Rabbit Polyclonal Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein corresponding to a region derived from 16-394 amino acids of human methionine adenosyltransferase I, alpha |
Transient overexpression of MAT1A (NM_000429) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of MAT1A (NM_000429) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of MAT1A (NM_000429) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack