Products

Proteins (9)
cDNA Clones (8)
Antibodies (2)
Jump to Filters
View as table Download
MCP4 (CCL13) (NM_005408) Human Tagged ORF Clone
RC203789

USD 98.00

USD 390.00

In Stock

CCL13 (Myc-DDK-tagged)-Human chemokine (C-C motif) ligand 13 (CCL13)

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
MCP4 (CCL13) (NM_005408) Human Tagged ORF Clone
RG203789

USD 460.00

In Stock

CCL13 (GFP-tagged) - Human chemokine (C-C motif) ligand 13 (CCL13)

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
MCP4 (CCL13) (NM_005408) Human Tagged ORF Clone
RC203789L3

USD 620.00

3 Weeks

Lenti ORF clone of Human chemokine (C-C motif) ligand 13 (CCL13), Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
MCP4 (CCL13) (NM_005408) Human Tagged ORF Clone
RC203789L4

USD 620.00

3 Weeks

Lenti ORF clone of Human chemokine (C-C motif) ligand 13 (CCL13), mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
MCP4 (CCL13) (NM_005408) Human Recombinant Protein
TP723841

USD 205.00

5 Days

Purified recombinant protein of Human chemokine (C-C motif) ligand 13 (CCL13 / MCP-4)

Tag Tag Free
Expression Host E. coli
MCP4 (CCL13) (NM_005408) Human Recombinant Protein
TP723286

USD 240.00

5 Days

Purified recombinant protein of Human chemokine (C-C motif) ligand 13 (CCL13).

Tag Tag Free
Expression Host E. coli
MCP4 (CCL13) (NM_005408) Human Over-expression Lysate
LY417327

USD 396.00

In Stock

Transient overexpression lysate of chemokine (C-C motif) ligand 13 (CCL13)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
MCP4 (CCL13) (NM_005408) Human Untagged Clone
SC116797

USD 310.00

In Stock

CCL13 (untagged)-Human chemokine (C-C motif) ligand 13 (CCL13)

Vector pCMV6-XL4
Tag Tag Free
Mammalian Cell Selection None
MCP4 (CCL13) (NM_005408) Human Over-expression Lysate
LC417327

USD 121.00

In Stock

CCL13 HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
MCP4 (CCL13) (BC008621) Human Untagged Clone
SC123724

USD 310.00

In Stock

CCL13 (untagged)-Human chemokine (C-C motif) ligand 13 (cDNA clone MGC:17134 IMAGE:4184250), complete cds

Vector pCMV6-XL5
Tag Tag Free
Mammalian Cell Selection None
MCP4 (CCL13) Rabbit Polyclonal Antibody
TA330376

USD 375.00

5 Days

Rabbit Polyclonal Anti-CCL13 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CCL13 antibody: synthetic peptide directed towards the middle region of human CCL13. Synthetic peptide located within the following region: KSYVITTSRCPQKAVIFRTKLGKEICADPKEKWVQNYMKHLGRKAHTLKT
MCP-4 / CCL13 (24-98, His-tag) Human Protein
AR09634PU-N

USD 845.00

2 Weeks

MCP-4 / CCL13 (24-98, His-tag) human recombinant protein, 50 µg

Tag His-tag
Expression Host E. coli
MCP-4 / CCL13 (24-98, His-tag) Human Protein
AR09634PU-S

USD 330.00

2 Weeks

MCP-4 / CCL13 (24-98, His-tag) human recombinant protein, 10 µg

Tag His-tag
Expression Host E. coli
MCP4 (CCL13) Rabbit Polyclonal Antibody
TA322619

USD 345.00

4 Weeks

Anti-CCL13 Rabbit Polyclonal Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 86-98 amino acids of Human C-C motif chemokine 13
MCP4 (CCL13) ICC Control Block
TB403789

USD 1,040.00

4 Weeks

Transient overexpression of CCL13 (NM_005408) in HEK293T cells paraffin embedded controls for ICC/IHC staining

MCP4 (CCL13) Cytosection
TS403789

USD 225.00

4 Weeks

Transient overexpression of CCL13 (NM_005408) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack

MCP4 (CCL13) Cytosection
TS403789P5

USD 889.00

4 Weeks

Transient overexpression of CCL13 (NM_005408) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack