CCL13 (Myc-DDK-tagged)-Human chemokine (C-C motif) ligand 13 (CCL13)
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
CCL13 (Myc-DDK-tagged)-Human chemokine (C-C motif) ligand 13 (CCL13)
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
CCL13 (GFP-tagged) - Human chemokine (C-C motif) ligand 13 (CCL13)
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
Lenti ORF clone of Human chemokine (C-C motif) ligand 13 (CCL13), Myc-DDK-tagged
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, CCL13 (Myc-DDK tagged) - Human chemokine (C-C motif) ligand 13 (CCL13), 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF clone of Human chemokine (C-C motif) ligand 13 (CCL13), mGFP tagged
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, CCL13 (mGFP-tagged) - Human chemokine (C-C motif) ligand 13 (CCL13), 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Purified recombinant protein of Human chemokine (C-C motif) ligand 13 (CCL13 / MCP-4)
Tag | Tag Free |
Expression Host | E. coli |
Purified recombinant protein of Human chemokine (C-C motif) ligand 13 (CCL13).
Tag | Tag Free |
Expression Host | E. coli |
Transient overexpression lysate of chemokine (C-C motif) ligand 13 (CCL13)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
CCL13 (untagged)-Human chemokine (C-C motif) ligand 13 (CCL13)
Vector | pCMV6-XL4 |
Tag | Tag Free |
Mammalian Cell Selection | None |
CCL13 HEK293T cell transient overexpression lysate (as WB positive control)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
CCL13 (untagged)-Human chemokine (C-C motif) ligand 13 (cDNA clone MGC:17134 IMAGE:4184250), complete cds
Vector | pCMV6-XL5 |
Tag | Tag Free |
Mammalian Cell Selection | None |
Rabbit Polyclonal Anti-CCL13 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-CCL13 antibody: synthetic peptide directed towards the middle region of human CCL13. Synthetic peptide located within the following region: KSYVITTSRCPQKAVIFRTKLGKEICADPKEKWVQNYMKHLGRKAHTLKT |
MCP-4 / CCL13 (24-98, His-tag) human recombinant protein, 50 µg
Tag | His-tag |
Expression Host | E. coli |
MCP-4 / CCL13 (24-98, His-tag) human recombinant protein, 10 µg
Tag | His-tag |
Expression Host | E. coli |
Anti-CCL13 Rabbit Polyclonal Antibody
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide corresponding to a region derived from 86-98 amino acids of Human C-C motif chemokine 13 |
Transient overexpression of CCL13 (NM_005408) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of CCL13 (NM_005408) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of CCL13 (NM_005408) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack