CD40 (Myc-DDK-tagged)-Human CD40 molecule, TNF receptor superfamily member 5 (CD40), transcript variant 1
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
CD40 (Myc-DDK-tagged)-Human CD40 molecule, TNF receptor superfamily member 5 (CD40), transcript variant 1
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
CD40 (untagged)-Human CD40 molecule, TNF receptor superfamily member 5 (CD40), transcript variant 1
Vector | pCMV6-XL5 |
Tag | Tag Free |
Mammalian Cell Selection | None |
CD40 (Myc-DDK-tagged)-Human CD40 molecule, TNF receptor superfamily member 5 (CD40), transcript variant 2
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
Lenti ORF particles, CD40 (Myc-DDK tagged) - Human CD40 molecule, TNF receptor superfamily member 5 (CD40), transcript variant 1, 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK |
Tag | Myc-DDK |
CD40 (GFP-tagged) - Human CD40 molecule, TNF receptor superfamily member 5 (CD40), transcript variant 1
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
Lenti ORF clone of Human CD40 molecule, TNF receptor superfamily member 5 (CD40), transcript variant 1, Myc-DDK-tagged
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, CD40 (Myc-DDK tagged) - Human CD40 molecule, TNF receptor superfamily member 5 (CD40), transcript variant 1, 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, CD40 (mGFP-tagged) - Human CD40 molecule, TNF receptor superfamily member 5 (CD40), transcript variant 1, 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Lenti ORF clone of Human CD40 molecule, TNF receptor superfamily member 5 (CD40), transcript variant 2, Myc-DDK-tagged
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, CD40 (Myc-DDK tagged) - Human CD40 molecule, TNF receptor superfamily member 5 (CD40), transcript variant 2, 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF clone of Human CD40 molecule, TNF receptor superfamily member 5 (CD40), transcript variant 2, mGFP tagged
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, CD40 (mGFP-tagged) - Human CD40 molecule, TNF receptor superfamily member 5 (CD40), transcript variant 2, 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
CD40 (myc-DDK-tagged) - Human CD40 molecule, TNF receptor superfamily member 5 (CD40), transcript variant 3
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
CD40 (GFP-tagged) - Human CD40 molecule, TNF receptor superfamily member 5 (CD40), transcript variant 2
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
Lenti ORF clone of Human CD40 molecule, TNF receptor superfamily member 5 (CD40), transcript variant 1, Myc-DDK-tagged
Vector | pLenti-C-Myc-DDK |
Tag | Myc-DDK |
Mammalian Cell Selection | None |
Lenti ORF clone of Human CD40 molecule, TNF receptor superfamily member 5 (CD40), transcript variant 1, mGFP tagged
Vector | pLenti-C-mGFP |
Tag | mGFP |
Mammalian Cell Selection | None |
Lenti ORF clone of Human CD40 molecule, TNF receptor superfamily member 5 (CD40), transcript variant 1, mGFP tagged
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Rabbit polyclonal anti-CD40 antibody
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from C-terminal of human CD40. |
Transient overexpression lysate of CD40 molecule, TNF receptor superfamily member 5 (CD40), transcript variant 1
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
CD40 mouse monoclonal antibody, clone B-B20, Azide Free
Applications | FC, FN, IHC |
Reactivities | Human |
CD40 (C-term) rabbit polyclonal antibody, Purified
Applications | IHC, IP, WB |
Reactivities | Human, Mouse, Rat |
Immunogen | CD40 antibody was raised against a synthetic peptide derived from C-terminal of human CD40 |
CD40 (untagged)-Human CD40 molecule, TNF receptor superfamily member 5 (CD40), transcript variant 2
Vector | pCMV6-Entry |
Tag | Tag Free |
Mammalian Cell Selection | Neomycin |
Mouse Anti-Human CD40 Purified (100 ug)
Reactivities | Human |
Conjugation | Unconjugated |
Rabbit Polyclonal Anti-CD40 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-CD40 antibody: synthetic peptide directed towards the N terminal of human CD40. Synthetic peptide located within the following region: SQCCSLCQPGQKLVSDCTEFTETECLPCGESEFLDTWNRETHCHQHKYCD |
Rabbit Polyclonal Anti-CD40 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-CD40 antibody: synthetic peptide directed towards the N terminal of human CD40. Synthetic peptide located within the following region: WNRETHCHQHKYCDPNLGLRVQQKGTSETDTICTCEEGWHCTSEACESCV |
Purified recombinant protein of Human CD40 molecule, TNF receptor superfamily member 5 (CD40), transcript variant 1
Tag | C-His |
Expression Host | HEK293 |
CD40 (untagged) - Human CD40 molecule, TNF receptor superfamily member 5 (CD40), transcript variant 3
Vector | pCMV6-Entry |
Tag | Tag Free |
Mammalian Cell Selection | Neomycin |
CD40 (21-193, His-tag) human recombinant protein, 50 µg
Tag | His-tag |
Expression Host | E. coli |
CD40 HEK293T cell transient overexpression lysate (as WB positive control)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
CD40 HEK293T cell transient overexpression lysate (as WB positive control)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
CD40 mouse monoclonal antibody, clone B-B20, Biotin
Applications | FC |
Reactivities | Human |
Conjugation | Biotin |
CD40 mouse monoclonal antibody, clone B-B20, FITC
Applications | FC |
Reactivities | Human |
Conjugation | FITC |
CD40 mouse monoclonal antibody, clone B-B20, Purified
Applications | FC |
Reactivities | Human |
CD40 mouse monoclonal antibody, clone B-B20, PE
Applications | FC |
Reactivities | Human |
Conjugation | PE |
CD40 (N-term) rabbit polyclonal antibody, Aff - Purified
Applications | WB |
Reactivities | Human, Mouse, Rat |
Immunogen | A synthetic peptide corresponding to a sequence at the N-terminal of mouse CD40 |
Rabbit polyclonal anti-CD40 antibody
Applications | WB |
Reactivities | Human, Monkey, Mouse, Rat, Pig |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide corresponding to residues surrounding amino acids 261 of human CD40 |
Rabbit anti CD40 Polyclonal Antibody
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
CD40 (21-193, His-tag) human recombinant protein, 0.25 mg
Tag | His-tag |
Expression Host | E. coli |
Carrier-free (BSA/glycerol-free) CD40 mouse monoclonal antibody, clone OTI8B8 (formerly 8B8)
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) CD40 mouse monoclonal antibody, clone OTI7H2 (formerly 7H2)
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) CD40 mouse monoclonal antibody, clone OTI8G5 (formerly 8G5)
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) CD40 mouse monoclonal antibody, clone OTI8C5 (formerly 8C5)
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) CD40 mouse monoclonal antibody, clone OTI6C12 (formerly 6C12)
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) CD40 mouse monoclonal antibody, clone OTI1F12 (formerly 1F12)
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) CD40 mouse monoclonal antibody, clone OTI9D8 (formerly 9D8)
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) CD40 mouse monoclonal antibody, clone OTI5C9 (formerly 5C9)
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) CD40 mouse monoclonal antibody, clone OTI9F4 (formerly 9F4)
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) CD40 mouse monoclonal antibody, clone OTI7F6 (formerly 7F6)
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) CD40 mouse monoclonal antibody,clone OTI3A9
Applications | FC |
Reactivities | Human |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) CD40 mouse monoclonal antibody,clone OTI2C7
Applications | FC |
Reactivities | Human |
Conjugation | Unconjugated |