Products

cDNA Clones (14)
Proteins (8)
Antibodies (2)
Jump to Filters
View as table Download
POLR3B (NM_001160708) Human Tagged ORF Clone
RC229060

USD 880.00

In Stock

POLR3B (Myc-DDK-tagged)-Human polymerase (RNA) III (DNA directed) polypeptide B (POLR3B), transcript variant 2

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
POLR3B (NM_018082) Human Tagged ORF Clone
RC208356

USD 880.00

In Stock

POLR3B (Myc-DDK-tagged)-Human polymerase (RNA) III (DNA directed) polypeptide B (POLR3B), transcript variant 1

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
POLR3B (NM_018082) Human Tagged ORF Clone
RC208356L3

USD 1,080.00

3 Weeks

Lenti-ORF clone of POLR3B (Myc-DDK-tagged)-Human polymerase (RNA) III (DNA directed) polypeptide B (POLR3B), transcript variant 1

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
POLR3B (NM_018082) Human Tagged ORF Clone Lentiviral Particle
RC208356L3V

USD 1,280.00

6 Weeks

Lenti ORF particles, POLR3B (Myc-DDK-tagged)-Human polymerase (RNA) III (DNA directed) polypeptide B (POLR3B), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
POLR3B (NM_018082) Human Tagged ORF Clone
RC208356L4

USD 1,080.00

3 Weeks

Lenti-ORF clone of POLR3B (mGFP-tagged)-Human polymerase (RNA) III (DNA directed) polypeptide B (POLR3B), transcript variant 1

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
POLR3B (NM_018082) Human Tagged ORF Clone Lentiviral Particle
RC208356L4V

USD 1,280.00

6 Weeks

Lenti ORF particles, POLR3B (mGFP-tagged)-Human polymerase (RNA) III (DNA directed) polypeptide B (POLR3B), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
POLR3B (NM_001160708) Human Tagged ORF Clone
RC229060L3

USD 1,080.00

3 Weeks

Lenti-ORF clone of POLR3B (Myc-DDK-tagged)-Human polymerase (RNA) III (DNA directed) polypeptide B (POLR3B), transcript variant 2

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
POLR3B (NM_001160708) Human Tagged ORF Clone Lentiviral Particle
RC229060L3V

USD 1,280.00

6 Weeks

Lenti ORF particles, POLR3B (Myc-DDK-tagged)-Human polymerase (RNA) III (DNA directed) polypeptide B (POLR3B), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
POLR3B (NM_001160708) Human Tagged ORF Clone
RC229060L4

USD 1,080.00

3 Weeks

Lenti-ORF clone of POLR3B (mGFP-tagged)-Human polymerase (RNA) III (DNA directed) polypeptide B (POLR3B), transcript variant 2

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
POLR3B (NM_001160708) Human Tagged ORF Clone Lentiviral Particle
RC229060L4V

USD 1,280.00

6 Weeks

Lenti ORF particles, POLR3B (mGFP-tagged)-Human polymerase (RNA) III (DNA directed) polypeptide B (POLR3B), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
POLR3B (NM_018082) Human Tagged ORF Clone
RG208356

USD 970.00

3 Weeks

POLR3B (GFP-tagged) - Human polymerase (RNA) III (DNA directed) polypeptide B (POLR3B), transcript variant 1

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
POLR3B (NM_001160708) Human Tagged ORF Clone
RG229060

USD 970.00

3 Weeks

POLR3B (GFP-tagged) - Human polymerase (RNA) III (DNA directed) polypeptide B (POLR3B), transcript variant 2

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
POLR3B Rabbit Polyclonal Antibody
TA346793

USD 475.00

5 Days

Rabbit Polyclonal Anti-POLR3B Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-POLR3B antibody: synthetic peptide directed towards the C terminal of human POLR3B. Synthetic peptide located within the following region: IEKVMISSNAEDAFLIKMLLRQTRRPEIGDKFSSRHGQKGVCGLIVPQED
POLR3B (NM_018082) Human Untagged Clone
SC113761

USD 310.00

In Stock

POLR3B (untagged)-Human polymerase (RNA) III (DNA directed) polypeptide B (POLR3B), transcript variant 1

Vector pCMV6-XL4
Tag Tag Free
Mammalian Cell Selection None
POLR3B Rabbit Polyclonal Antibody
TA315598

USD 345.00

4 Weeks

Rabbit polyclonal anti-RPC2 antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human RPC2.
POLR3B (NM_018082) Human Over-expression Lysate
LC413324

USD 121.00

2 Weeks

POLR3B HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
POLR3B (NM_018082) Human Over-expression Lysate
LY413324

USD 396.00

5 Days

Transient overexpression lysate of polymerase (RNA) III (DNA directed) polypeptide B (POLR3B), transcript variant 1

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
POLR3B (NM_001160708) Human Untagged Clone
SC327695

USD 1,100.00

6 Weeks

POLR3B (untagged)-Human polymerase (RNA) III (DNA directed) polypeptide B (POLR3B) transcript variant 2

Vector pCMV6-XL5
Tag Tag Free
Mammalian Cell Selection None
POLR3B (NM_018082) ICC Control Block
TB408356

USD 1,530.00

4 Weeks

Transient overexpression of POLR3B (NM_018082) in HEK293T cells paraffin embedded controls for ICC/IHC staining

POLR3B (NM_001160708) ICC Control Block
TB429060

USD 1,530.00

4 Weeks

Transient overexpression of POLR3B (NM_001160708) in HEK293T cells paraffin embedded controls for ICC/IHC staining

POLR3B Cytosection
TS408356

USD 225.00

4 Weeks

Transient overexpression of POLR3B (NM_018082) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack

POLR3B Cytosection
TS408356P5

USD 889.00

4 Weeks

Transient overexpression of POLR3B (NM_018082) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack

POLR3B Cytosection
TS429060

USD 225.00

4 Weeks

Transient overexpression of POLR3B (NM_001160708) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack

POLR3B Cytosection
TS429060P5

USD 889.00

4 Weeks

Transient overexpression of POLR3B (NM_001160708) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack