Products

Proteins (7)
cDNA Clones (7)
Antibodies (2)
Jump to Filters
View as table Download
gamma Sarcoglycan (SGCG) (NM_000231) Human Tagged ORF Clone
RG220093

USD 460.00

In Stock

SGCG (GFP-tagged) - Human sarcoglycan, gamma (35kDa dystrophin-associated glycoprotein) (SGCG)

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
gamma Sarcoglycan (SGCG) (NM_000231) Human Tagged ORF Clone
RC220093L3

USD 620.00

3 Weeks

Lenti ORF clone of Human sarcoglycan, gamma (35kDa dystrophin-associated glycoprotein) (SGCG), Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
gamma Sarcoglycan (SGCG) (NM_000231) Human Tagged ORF Clone Lentiviral Particle
RC220093L3V

USD 820.00

6 Weeks

Lenti ORF particles, SGCG (Myc-DDK tagged) - Human sarcoglycan, gamma (35kDa dystrophin-associated glycoprotein) (SGCG), 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
gamma Sarcoglycan (SGCG) (NM_000231) Human Tagged ORF Clone
RC220093L4

USD 620.00

3 Weeks

Lenti ORF clone of Human sarcoglycan, gamma (35kDa dystrophin-associated glycoprotein) (SGCG), mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
gamma Sarcoglycan (SGCG) (NM_000231) Human Tagged ORF Clone Lentiviral Particle
RC220093L4V

USD 820.00

6 Weeks

Lenti ORF particles, SGCG (mGFP-tagged) - Human sarcoglycan, gamma (35kDa dystrophin-associated glycoprotein) (SGCG), 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
gamma Sarcoglycan (SGCG) (NM_000231) Human Over-expression Lysate
LY424852

USD 396.00

In Stock

Transient overexpression lysate of sarcoglycan, gamma (35kDa dystrophin-associated glycoprotein) (SGCG)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
gamma Sarcoglycan (SGCG) (NM_000231) Human Over-expression Lysate
LC424852

USD 121.00

In Stock

SGCG HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
gamma Sarcoglycan (SGCG) Rabbit Polyclonal Antibody
TA325183

USD 450.00

5 Days

Rabbit polyclonal SGCG Antibody (Center)

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen This SGCG antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 145-172 amino acids from the Central region of human SGCG.
gamma Sarcoglycan (SGCG) Rabbit Polyclonal Antibody
TA334659

USD 310.00

5 Days

Rabbit Polyclonal Anti-SGCG Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-SGCG antibody: synthetic peptide directed towards the middle region of human SGCG. Synthetic peptide located within the following region: FTVDEKEVVVGTDKLRVTGPEGALFEHSVETPLVRADPFQDLRLESPTRS
gamma Sarcoglycan (SGCG) (NM_000231) Human Mass Spec Standard
PH320093

USD 2,055.00

3 Weeks

SGCG MS Standard C13 and N15-labeled recombinant protein (NP_000222)

Tag C-Myc/DDK
Expression Host HEK293
gamma Sarcoglycan (SGCG) (NM_000231) Human Untagged Clone
SC300030

USD 660.00

3 Weeks

SGCG (untagged)-Human sarcoglycan, gamma (35kDa dystrophin-associated glycoprotein) (SGCG)

Vector pCMV6-Entry
Tag Tag Free
Mammalian Cell Selection Neomycin
gamma Sarcoglycan (SGCG) ICC Control Block
TB420093

USD 1,070.00

4 Weeks

Transient overexpression of SGCG (NM_000231) in HEK293T cells paraffin embedded controls for ICC/IHC staining

gamma Sarcoglycan (SGCG) Cytosection
TS420093

USD 225.00

4 Weeks

Transient overexpression of SGCG (NM_000231) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack

gamma Sarcoglycan (SGCG) Cytosection
TS420093P5

USD 889.00

4 Weeks

Transient overexpression of SGCG (NM_000231) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack