Products

cDNA Clones (13)
Proteins (4)
Antibodies (2)
Jump to Filters
View as table Download
UGT2B15 (NM_001076) Human Tagged ORF Clone Lentiviral Particle
RC215344L1V

USD 880.00

3 Weeks

Lenti ORF particles, UGT2B15 (Myc-DDK-tagged)-Human UDP glucuronosyltransferase 2 family, polypeptide B15 (UGT2B15), 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
  • LentiORF®
UGT2B15 (NM_001076) Human Tagged ORF Clone Lentiviral Particle
RC215344L2V

USD 880.00

3 Weeks

Lenti ORF particles, UGT2B15 (mGFP-tagged)-Human UDP glucuronosyltransferase 2 family, polypeptide B15 (UGT2B15), 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP
Tag mGFP
  • LentiORF®
UGT2B15 (NM_001076) Human Tagged ORF Clone
RC215344

USD 480.00

In Stock

UGT2B15 (Myc-DDK-tagged)-Human UDP glucuronosyltransferase 2 family, polypeptide B15 (UGT2B15)

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
UGT2B15 (NM_001076) Human Tagged ORF Clone
RC215344L3

USD 680.00

3 Weeks

Lenti-ORF clone of UGT2B15 (Myc-DDK-tagged)-Human UDP glucuronosyltransferase 2 family, polypeptide B15 (UGT2B15)

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
UGT2B15 (NM_001076) Human Tagged ORF Clone Lentiviral Particle
RC215344L3V

USD 880.00

11 Weeks

Lenti ORF particles, UGT2B15 (Myc-DDK-tagged)-Human UDP glucuronosyltransferase 2 family, polypeptide B15 (UGT2B15), 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
UGT2B15 (NM_001076) Human Tagged ORF Clone
RC215344L4

USD 680.00

3 Weeks

Lenti-ORF clone of UGT2B15 (mGFP-tagged)-Human UDP glucuronosyltransferase 2 family, polypeptide B15 (UGT2B15)

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
UGT2B15 (NM_001076) Human Tagged ORF Clone Lentiviral Particle
RC215344L4V

USD 880.00

11 Weeks

Lenti ORF particles, UGT2B15 (mGFP-tagged)-Human UDP glucuronosyltransferase 2 family, polypeptide B15 (UGT2B15), 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
UGT2B15 (NM_001076) Human Tagged ORF Clone
RG215344

USD 530.00

3 Weeks

UGT2B15 (GFP-tagged) - Human UDP glucuronosyltransferase 2 family, polypeptide B15 (UGT2B15)

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
UGT2B15 (NM_001076) Human Tagged Lenti ORF Clone
RC215344L1

USD 840.00

In Stock

Lenti-ORF clone of UGT2B15 (Myc-DDK-tagged)-Human UDP glucuronosyltransferase 2 family, polypeptide B15 (UGT2B15)

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
Mammalian Cell Selection None
  • LentiORF®
UGT2B15 (NM_001076) Human Tagged Lenti ORF Clone
RC215344L2

USD 840.00

In Stock

Lenti-ORF clone of UGT2B15 (mGFP-tagged)-Human UDP glucuronosyltransferase 2 family, polypeptide B15 (UGT2B15)

Vector pLenti-C-mGFP
Tag mGFP
Mammalian Cell Selection None
  • LentiORF®
UGT2B15 (NM_001076) Human Untagged Clone
SC123996

USD 900.00

In Stock

UGT2B15 (untagged)-Human UDP glucuronosyltransferase 2 family, polypeptide B15 (UGT2B15)

Vector pCMV6-XL4
Tag Tag Free
Mammalian Cell Selection None
SC123996 is the updated version of SC111052.
UGT2B15 Rabbit Polyclonal Antibody
TA346272

USD 475.00

5 Days

Rabbit Polyclonal Anti-UGT2B15 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-UGT2B15 antibody: synthetic peptide directed towards the N terminal of human UGT2B15. Synthetic peptide located within the following region: IKLEVYPTSLTKNYLEDSLLKILDRWIYGVSKNTFWSYFSQLQELCWEYY
UGT2B15 (Center) Rabbit Polyclonal Antibody
AP54455PU-N

USD 450.00

2 Weeks

UGT2B15 (Center) rabbit polyclonal antibody, Aff - Purified

Applications IF, IHC, WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide between 163-193 amino acids from the Central region of human UGT2B15
UGT2B15 (NM_001076) Human Mass Spec Standard
PH315344

USD 2,055.00

3 Weeks

UGT2B15 MS Standard C13 and N15-labeled recombinant protein (NP_001067)

Tag C-Myc/DDK
Expression Host HEK293
UGT2B15 (NM_001076) Human Untagged Clone
SC317899

USD 900.00

3 Weeks

UGT2B15 (untagged)-Human UDP glucuronosyltransferase 2 family, polypeptide B15 (UGT2B15)

Vector pCMV6-Entry
Tag Tag Free
Mammalian Cell Selection Neomycin
UGT2B15 (NM_001076) Human Untagged Clone
SC317900

USD 900.00

3 Weeks

UGT2B15 (untagged)-Human UDP glucuronosyltransferase 2 family, polypeptide B15 (UGT2B15)

Vector pCMV6-Entry
Tag Tag Free
Mammalian Cell Selection Neomycin
UGT2B15 ICC Control Block
TB415344

USD 1,130.00

4 Weeks

Transient overexpression of UGT2B15 (NM_001076) in HEK293T cells paraffin embedded controls for ICC/IHC staining

UGT2B15 Cytosection
TS415344

USD 225.00

4 Weeks

Transient overexpression of UGT2B15 (NM_001076) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack

UGT2B15 Cytosection
TS415344P5

USD 889.00

4 Weeks

Transient overexpression of UGT2B15 (NM_001076) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack