EPN1 (Myc-DDK-tagged)-Human epsin 1 (EPN1), transcript variant 3
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
EPN1 (Myc-DDK-tagged)-Human epsin 1 (EPN1), transcript variant 3
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
EPN1 (Myc-DDK-tagged)-Human epsin 1 (EPN1), transcript variant 2
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
EPN1 (Myc-DDK-tagged)-Human epsin 1 (EPN1), transcript variant 1
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
Recombinant protein of human epsin 1 (EPN1), transcript variant 3
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Special Offer: Get a 20% discount on this product. Use code: "MVPro20".
USD 820.00
3 Weeks
Lenti ORF particles, EPN1 (Myc-DDK tagged) - Human epsin 1 (EPN1), transcript variant 3, 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK |
Tag | Myc-DDK |
USD 820.00
6 Weeks
Lenti ORF particles, EPN1 (mGFP-tagged) - Human epsin 1 (EPN1), transcript variant 3, 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP |
Tag | mGFP |
EPN1 (GFP-tagged) - Human epsin 1 (EPN1), transcript variant 3
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
Lenti ORF clone of Human epsin 1 (EPN1), transcript variant 3, Myc-DDK-tagged
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
USD 820.00
5 Weeks
Lenti ORF particles, EPN1 (Myc-DDK tagged) - Human epsin 1 (EPN1), transcript variant 3, 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF clone of Human epsin 1 (EPN1), transcript variant 3, mGFP tagged
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
USD 820.00
7 Weeks
Lenti ORF particles, EPN1 (mGFP-tagged) - Human epsin 1 (EPN1), transcript variant 3, 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Lenti-ORF clone of EPN1 (Myc-DDK-tagged)-Human epsin 1 (EPN1), transcript variant 2
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
USD 880.00
6 Weeks
Lenti ORF particles, EPN1 (Myc-DDK-tagged)-Human epsin 1 (EPN1), transcript variant 2, 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti-ORF clone of EPN1 (mGFP-tagged)-Human epsin 1 (EPN1), transcript variant 2
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
USD 880.00
6 Weeks
Lenti ORF particles, EPN1 (mGFP-tagged)-Human epsin 1 (EPN1), transcript variant 2, 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Lenti-ORF clone of EPN1 (Myc-DDK-tagged)-Human epsin 1 (EPN1), transcript variant 1
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
USD 880.00
6 Weeks
Lenti ORF particles, EPN1 (Myc-DDK-tagged)-Human epsin 1 (EPN1), transcript variant 1, 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti-ORF clone of EPN1 (mGFP-tagged)-Human epsin 1 (EPN1), transcript variant 1
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
USD 880.00
6 Weeks
Lenti ORF particles, EPN1 (mGFP-tagged)-Human epsin 1 (EPN1), transcript variant 1, 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
EPN1 (GFP-tagged) - Human epsin 1 (EPN1), transcript variant 2
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
EPN1 (GFP-tagged) - Human epsin 1 (EPN1), transcript variant 1
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
Lenti ORF clone of Human epsin 1 (EPN1), transcript variant 3, Myc-DDK-tagged
Vector | pLenti-C-Myc-DDK |
Tag | Myc-DDK |
Mammalian Cell Selection | None |
Rabbit Polyclonal Anti-EPN1 Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-EPN1 Antibody: A synthesized peptide derived from human EPN1 |
Lenti ORF clone of Human epsin 1 (EPN1), transcript variant 3, mGFP tagged
Vector | pLenti-C-mGFP |
Tag | mGFP |
Mammalian Cell Selection | None |
EPN1 HEK293T cell transient overexpression lysate (as WB positive control)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
EPN1 HEK293T cell transient overexpression lysate (as WB positive control)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
Transient overexpression lysate of epsin 1 (EPN1), transcript variant 3
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
Transient overexpression lysate of epsin 1 (EPN1), transcript variant 1
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
Transient overexpression lysate of epsin 1 (EPN1), transcript variant 2
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
EPN1 (untagged)-Human epsin 1 (EPN1), transcript variant 3
Vector | pCMV6-AC |
Tag | Tag Free |
Mammalian Cell Selection | Neomycin |
Rabbit polyclonal anti-EPN1 antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from Internal of human EPN1. |
Rabbit Polyclonal Anti-EPN1 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-EPN1 antibody: synthetic peptide directed towards the C terminal of human EPN1. Synthetic peptide located within the following region: AATPTPTPPTRKTPESFLGPNAALVDLDSLVSRPGPTPPGAKASNPFLPG |
Rabbit Polyclonal Anti-EPN1 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-EPN1 antibody is: synthetic peptide directed towards the C-terminal region of Human EPN1. Synthetic peptide located within the following region: VSRPGPTPPGAKASNPFLPGGGPATGPSVTNPFQPAPPATLTLNQLRLSP |
EPN1 HEK293T cell transient overexpression lysate (as WB positive control)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
EPN1 MS Standard C13 and N15-labeled recombinant protein (NP_037465)
Tag | C-Myc/DDK |
Expression Host | HEK293 |
EPN1 (untagged)-Human epsin 1 (EPN1), transcript variant 2
Vector | pCMV6-Entry |
Tag | Tag Free |
Mammalian Cell Selection | Neomycin |
EPN1 (untagged)-Human epsin 1 (EPN1), transcript variant 1
Vector | pCMV6-Entry |
Tag | Tag Free |
Mammalian Cell Selection | Neomycin |
Transient overexpression of EPN1 (NM_013333) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of EPN1 (NM_001130072) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of EPN1 (NM_001130071) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of EPN1 (NM_013333) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of EPN1 (NM_013333) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack
Transient overexpression of EPN1 (NM_001130072) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of EPN1 (NM_001130072) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack
Transient overexpression of EPN1 (NM_001130071) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of EPN1 (NM_001130071) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack