Products

cDNA Clones (25)
Proteins (17)
Antibodies (4)
Jump to Filters
View as table Download
Epsin 1 (EPN1) (NM_001130072) Human Tagged ORF Clone
RC225973

USD 480.00

In Stock

EPN1 (Myc-DDK-tagged)-Human epsin 1 (EPN1), transcript variant 2

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
Epsin 1 (EPN1) (NM_001130071) Human Tagged ORF Clone
RC226076

USD 480.00

In Stock

EPN1 (Myc-DDK-tagged)-Human epsin 1 (EPN1), transcript variant 1

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
Epsin 1 (EPN1) (NM_013333) Human Tagged ORF Clone
RG207099

USD 460.00

In Stock

EPN1 (GFP-tagged) - Human epsin 1 (EPN1), transcript variant 3

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
Epsin 1 (EPN1) (NM_013333) Human Tagged ORF Clone
RC207099L3

USD 620.00

3 Weeks

Lenti ORF clone of Human epsin 1 (EPN1), transcript variant 3, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Epsin 1 (EPN1) (NM_013333) Human Tagged ORF Clone
RC207099L4

USD 620.00

3 Weeks

Lenti ORF clone of Human epsin 1 (EPN1), transcript variant 3, mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
Epsin 1 (EPN1) (NM_001130072) Human Tagged ORF Clone
RC225973L3

USD 680.00

3 Weeks

Lenti-ORF clone of EPN1 (Myc-DDK-tagged)-Human epsin 1 (EPN1), transcript variant 2

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Epsin 1 (EPN1) (NM_001130072) Human Tagged ORF Clone
RC225973L4

USD 680.00

3 Weeks

Lenti-ORF clone of EPN1 (mGFP-tagged)-Human epsin 1 (EPN1), transcript variant 2

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
Epsin 1 (EPN1) (NM_001130071) Human Tagged ORF Clone
RC226076L3

USD 680.00

3 Weeks

Lenti-ORF clone of EPN1 (Myc-DDK-tagged)-Human epsin 1 (EPN1), transcript variant 1

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Epsin 1 (EPN1) (NM_001130071) Human Tagged ORF Clone
RC226076L4

USD 680.00

3 Weeks

Lenti-ORF clone of EPN1 (mGFP-tagged)-Human epsin 1 (EPN1), transcript variant 1

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
Epsin 1 (EPN1) (NM_001130072) Human Tagged ORF Clone
RG225973

USD 530.00

3 Weeks

EPN1 (GFP-tagged) - Human epsin 1 (EPN1), transcript variant 2

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
Epsin 1 (EPN1) (NM_001130071) Human Tagged ORF Clone
RG226076

USD 530.00

3 Weeks

EPN1 (GFP-tagged) - Human epsin 1 (EPN1), transcript variant 1

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
Epsin 1 (EPN1) Rabbit Polyclonal Antibody
TA347746

USD 380.00

4 Weeks

Rabbit Polyclonal Anti-EPN1 Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-EPN1 Antibody: A synthesized peptide derived from human EPN1
Epsin 1 (EPN1) (NM_013333) Human Tagged ORF Clone
RC207099L2

USD 620.00

3 Weeks

Lenti ORF clone of Human epsin 1 (EPN1), transcript variant 3, mGFP tagged

Vector pLenti-C-mGFP
Tag mGFP
Mammalian Cell Selection None
  • LentiORF®
Epsin 1 (EPN1) (NM_013333) Human Over-expression Lysate
LC415639

USD 121.00

In Stock

EPN1 HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
Epsin 1 (EPN1) (NM_001130072) Human Over-expression Lysate
LC427146

USD 121.00

In Stock

EPN1 HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
Epsin 1 (EPN1) (NM_013333) Human Over-expression Lysate
LY415639

USD 396.00

5 Days

Transient overexpression lysate of epsin 1 (EPN1), transcript variant 3

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
Epsin 1 (EPN1) (NM_001130071) Human Over-expression Lysate
LY427145

USD 396.00

In Stock

Transient overexpression lysate of epsin 1 (EPN1), transcript variant 1

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
Epsin 1 (EPN1) (NM_001130072) Human Over-expression Lysate
LY427146

USD 396.00

In Stock

Transient overexpression lysate of epsin 1 (EPN1), transcript variant 2

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
Epsin 1 (EPN1) (NM_013333) Human Untagged Clone
SC321861

USD 760.00

In Stock

EPN1 (untagged)-Human epsin 1 (EPN1), transcript variant 3

Vector pCMV6-AC
Tag Tag Free
Mammalian Cell Selection Neomycin
Epsin 1 (EPN1) Rabbit Polyclonal Antibody
TA312737

USD 345.00

4 Weeks

Rabbit polyclonal anti-EPN1 antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from Internal of human EPN1.
Epsin 1 (EPN1) Rabbit Polyclonal Antibody
TA334476

USD 375.00

5 Days

Rabbit Polyclonal Anti-EPN1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-EPN1 antibody: synthetic peptide directed towards the C terminal of human EPN1. Synthetic peptide located within the following region: AATPTPTPPTRKTPESFLGPNAALVDLDSLVSRPGPTPPGAKASNPFLPG
Epsin 1 (EPN1) Rabbit Polyclonal Antibody
TA334477

USD 375.00

5 Days

Rabbit Polyclonal Anti-EPN1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-EPN1 antibody is: synthetic peptide directed towards the C-terminal region of Human EPN1. Synthetic peptide located within the following region: VSRPGPTPPGAKASNPFLPGGGPATGPSVTNPFQPAPPATLTLNQLRLSP
Epsin 1 (EPN1) (NM_001130071) Human Over-expression Lysate
LC427145

USD 121.00

2 Weeks

EPN1 HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
Epsin 1 (EPN1) (NM_013333) Human Mass Spec Standard
PH307099

USD 2,055.00

3 Weeks

EPN1 MS Standard C13 and N15-labeled recombinant protein (NP_037465)

Tag C-Myc/DDK
Expression Host HEK293
Epsin 1 (EPN1) (NM_001130072) Human Untagged Clone
SC326080

USD 980.00

3 Weeks

EPN1 (untagged)-Human epsin 1 (EPN1), transcript variant 2

Vector pCMV6-Entry
Tag Tag Free
Mammalian Cell Selection Neomycin
Epsin 1 (EPN1) (NM_001130071) Human Untagged Clone
SC326155

USD 1,110.00

3 Weeks

EPN1 (untagged)-Human epsin 1 (EPN1), transcript variant 1

Vector pCMV6-Entry
Tag Tag Free
Mammalian Cell Selection Neomycin
Epsin 1 (EPN1) (NM_013333) ICC Control Block
TB407099

USD 1,070.00

4 Weeks

Transient overexpression of EPN1 (NM_013333) in HEK293T cells paraffin embedded controls for ICC/IHC staining

Epsin 1 (EPN1) (NM_001130072) ICC Control Block
TB425973

USD 1,130.00

4 Weeks

Transient overexpression of EPN1 (NM_001130072) in HEK293T cells paraffin embedded controls for ICC/IHC staining

Epsin 1 (EPN1) (NM_001130071) ICC Control Block
TB426076

USD 1,130.00

4 Weeks

Transient overexpression of EPN1 (NM_001130071) in HEK293T cells paraffin embedded controls for ICC/IHC staining

Epsin 1 (EPN1) Cytosection
TS407099

USD 225.00

4 Weeks

Transient overexpression of EPN1 (NM_013333) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack

Epsin 1 (EPN1) Cytosection
TS407099P5

USD 889.00

4 Weeks

Transient overexpression of EPN1 (NM_013333) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack

Epsin 1 (EPN1) Cytosection
TS425973

USD 225.00

4 Weeks

Transient overexpression of EPN1 (NM_001130072) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack

Epsin 1 (EPN1) Cytosection
TS425973P5

USD 889.00

4 Weeks

Transient overexpression of EPN1 (NM_001130072) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack

Epsin 1 (EPN1) Cytosection
TS426076

USD 225.00

4 Weeks

Transient overexpression of EPN1 (NM_001130071) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack

Epsin 1 (EPN1) Cytosection
TS426076P5

USD 889.00

4 Weeks

Transient overexpression of EPN1 (NM_001130071) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack