Products

cDNA Clones (43)
Proteins (18)
RNAi (11)
Gene Expression (7)
Antibodies (6)
Jump to Filters
View as table Download
Epsin 1 (EPN1) (NM_001130072) Human Tagged ORF Clone
RC225973

USD 480.00

In Stock

EPN1 (Myc-DDK-tagged)-Human epsin 1 (EPN1), transcript variant 2

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
Epsin 1 (EPN1) (NM_001130071) Human Tagged ORF Clone
RC226076

USD 480.00

In Stock

EPN1 (Myc-DDK-tagged)-Human epsin 1 (EPN1), transcript variant 1

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
Epn1 (NM_010147) Mouse Tagged ORF Clone
MR209035

USD 480.00

In Stock

Epn1 (Myc-DDK-tagged) - Mouse epsin 1 (Epn1)

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
Epsin 1 (EPN1) (NM_013333) Human Tagged ORF Clone
RG207099

USD 460.00

In Stock

EPN1 (GFP-tagged) - Human epsin 1 (EPN1), transcript variant 3

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
Epn1 (NM_001252454) Mouse Tagged ORF Clone
MR230560

USD 480.00

In Stock

Epn1 (myc-DDK-tagged) - Mouse epsin 1 (Epn1), transcript variant 2

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
Epsin 1 (EPN1) Human Gene Knockout Kit (CRISPR)
KN407099

USD 1,290.00

2 Weeks

EPN1 - KN2.0, Human gene knockout kit via CRISPR, non-homology mediated.

Format 2 gRNA vectors, 1 linear donor
Donor DNA EF1a-GFP-P2A-Puro
KN407099 is the updated version of KN207099.
Epn1 Mouse Gene Knockout Kit (CRISPR)
KN505294

USD 1,290.00

2 Weeks

Epn1 - KN2.0, Mouse gene knockout kit via CRISPR, non-homology mediated.

Format 2 gRNA vectors, 1 linear donor
Donor DNA EF1a-GFP-P2A-Puro
KN505294 is the updated version of KN305294.
Epn1 (BC099682) Mouse Tagged ORF Clone
MG209035

USD 530.00

3 Weeks

Epn1 (GFP-tagged) - Mouse epsin 1 (cDNA clone MGC:106041 IMAGE:6529672)

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
Epn1 (NM_010147) Mouse Tagged ORF Clone
MR209035L3

USD 680.00

3 Weeks

Lenti ORF clone of Epn1 (Myc-DDK-tagged) - Mouse epsin 1 (Epn1)

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Epn1 (NM_010147) Mouse Tagged ORF Clone
MR209035L4

USD 680.00

3 Weeks

Lenti ORF clone of Epn1 (mGFP-tagged) - Mouse epsin 1 (Epn1)

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
Epsin 1 (EPN1) (NM_013333) Human Tagged ORF Clone
RC207099L3

USD 620.00

3 Weeks

Lenti ORF clone of Human epsin 1 (EPN1), transcript variant 3, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Epsin 1 (EPN1) (NM_013333) Human Tagged ORF Clone
RC207099L4

USD 620.00

3 Weeks

Lenti ORF clone of Human epsin 1 (EPN1), transcript variant 3, mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
Epsin 1 (EPN1) (NM_001130072) Human Tagged ORF Clone
RC225973L3

USD 680.00

3 Weeks

Lenti-ORF clone of EPN1 (Myc-DDK-tagged)-Human epsin 1 (EPN1), transcript variant 2

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Epsin 1 (EPN1) (NM_001130072) Human Tagged ORF Clone
RC225973L4

USD 680.00

3 Weeks

Lenti-ORF clone of EPN1 (mGFP-tagged)-Human epsin 1 (EPN1), transcript variant 2

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
Epsin 1 (EPN1) (NM_001130071) Human Tagged ORF Clone
RC226076L3

USD 680.00

3 Weeks

Lenti-ORF clone of EPN1 (Myc-DDK-tagged)-Human epsin 1 (EPN1), transcript variant 1

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Epsin 1 (EPN1) (NM_001130071) Human Tagged ORF Clone
RC226076L4

USD 680.00

3 Weeks

Lenti-ORF clone of EPN1 (mGFP-tagged)-Human epsin 1 (EPN1), transcript variant 1

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
Epsin 1 (EPN1) (NM_001130072) Human Tagged ORF Clone
RG225973

USD 530.00

3 Weeks

EPN1 (GFP-tagged) - Human epsin 1 (EPN1), transcript variant 2

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
Epsin 1 (EPN1) (NM_001130071) Human Tagged ORF Clone
RG226076

USD 530.00

3 Weeks

EPN1 (GFP-tagged) - Human epsin 1 (EPN1), transcript variant 1

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
Epn1 (NM_057136) Rat Tagged ORF Clone
RR210922

USD 770.00

5 Weeks

Epn1 (Myc-DDK-tagged ORF) - Rat Epsin 1 (Epn1), (10 ug)

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
Epn1 (NM_057136) Rat Tagged ORF Clone
RR210922L3

USD 980.00

10 Weeks

Lenti ORF clone of Epn1 (Myc-DDK-tagged ORF) - Rat Epsin 1 (Epn1), (10 ug)

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Epn1 (NM_057136) Rat Tagged ORF Clone
RR210922L4

USD 1,070.00

10 Weeks

Lenti ORF clone of Epn1 (mGFP-tagged ORF) - Rat Epsin 1 (Epn1), (10 ug)

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
Epsin 1 (EPN1) Rabbit Polyclonal Antibody
TA347746

USD 380.00

4 Weeks

Rabbit Polyclonal Anti-EPN1 Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-EPN1 Antibody: A synthesized peptide derived from human EPN1
Epsin 1 (EPN1) (NM_013333) Human Tagged ORF Clone
RC207099L2

USD 620.00

3 Weeks

Lenti ORF clone of Human epsin 1 (EPN1), transcript variant 3, mGFP tagged

Vector pLenti-C-mGFP
Tag mGFP
Mammalian Cell Selection None
  • LentiORF®
Epsin 1 (EPN1) (NM_013333) Human Over-expression Lysate
LC415639

USD 121.00

In Stock

EPN1 HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
Epsin 1 (EPN1) (NM_001130072) Human Over-expression Lysate
LC427146

USD 121.00

In Stock

EPN1 HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
Epsin 1 (EPN1) (NM_013333) Human Over-expression Lysate
LY415639

USD 396.00

5 Days

Transient overexpression lysate of epsin 1 (EPN1), transcript variant 3

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
Epsin 1 (EPN1) (NM_001130071) Human Over-expression Lysate
LY427145

USD 396.00

In Stock

Transient overexpression lysate of epsin 1 (EPN1), transcript variant 1

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
Epsin 1 (EPN1) (NM_001130072) Human Over-expression Lysate
LY427146

USD 396.00

In Stock

Transient overexpression lysate of epsin 1 (EPN1), transcript variant 2

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
Epsin 1 (EPN1) (NM_013333) Human Untagged Clone
SC321861

USD 760.00

In Stock

EPN1 (untagged)-Human epsin 1 (EPN1), transcript variant 3

Vector pCMV6-AC
Tag Tag Free
Mammalian Cell Selection Neomycin
Epsin 1 (EPN1) Rabbit Polyclonal Antibody
TA312737

USD 345.00

4 Weeks

Rabbit polyclonal anti-EPN1 antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from Internal of human EPN1.
Epsin 1 (EPN1) Rabbit Polyclonal Antibody
TA334476

USD 375.00

5 Days

Rabbit Polyclonal Anti-EPN1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-EPN1 antibody: synthetic peptide directed towards the C terminal of human EPN1. Synthetic peptide located within the following region: AATPTPTPPTRKTPESFLGPNAALVDLDSLVSRPGPTPPGAKASNPFLPG
Epsin 1 (EPN1) Rabbit Polyclonal Antibody
TA334477

USD 375.00

5 Days

Rabbit Polyclonal Anti-EPN1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-EPN1 antibody is: synthetic peptide directed towards the C-terminal region of Human EPN1. Synthetic peptide located within the following region: VSRPGPTPPGAKASNPFLPGGGPATGPSVTNPFQPAPPATLTLNQLRLSP
Epsin 1 (EPN1) Human shRNA Plasmid Kit (Locus ID 29924)
TR313189

USD 715.00

2 Weeks

EPN1 - Human, 4 unique 29mer shRNA constructs in retroviral untagged vector

Format Retroviral plasmids
Vector pRS
Human Epsin 1 (EPN1) activation kit by CRISPRa
GA109314

USD 1,290.00

2 Weeks

EPN1 CRISPRa kit - CRISPR gene activation of human epsin 1

Format 3gRNAs, 1 scramble ctrl and 1 enhancer vector
Mouse Epn1 activation kit by CRISPRa
GA201271

USD 1,290.00

2 Weeks

Epn1 CRISPRa kit - CRISPR gene activation of mouse epsin 1

Format 3gRNAs, 1 scramble ctrl and 1 enhancer vector