Germany
Japan
United Kingdom
China
RAB31 (Myc-DDK-tagged)-Human RAB31, member RAS oncogene family (RAB31)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
Products
View as table Download
Lenti ORF particles, RAB31 (Myc-DDK tagged) - Human RAB31, member RAS oncogene family (RAB31), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
| Mammalian Cell Selection | None |
- LentiORF®
-
Lenti ORF particles, RAB31 (mGFP-tagged) - Human RAB31, member RAS oncogene family (RAB31), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
| Mammalian Cell Selection | None |
- LentiORF®
-
Recombinant protein of human RAB31, member RAS oncogene family (RAB31)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
Special Offer: Get a 20% discount on this product. Use code: "MVPro20".
RAB31 (GFP-tagged) - Human RAB31, member RAS oncogene family (RAB31)
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti ORF clone of Human RAB31, member RAS oncogene family (RAB31), Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, RAB31 (Myc-DDK tagged) - Human RAB31, member RAS oncogene family (RAB31), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Human RAB31, member RAS oncogene family (RAB31), mGFP tagged
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, RAB31 (mGFP-tagged) - Human RAB31, member RAS oncogene family (RAB31), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Transient overexpression lysate of RAB31, member RAS oncogene family (RAB31)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
RAB31 (untagged)-Human RAB31, member RAS oncogene family (RAB31)
| Vector | pCMV6-XL5 |
| Tag | Tag Free |
| Mammalian Cell Selection | None |
Goat Polyclonal Anti-Rab31 Antibody
| Applications | WB |
| Reactivities | Canine, Human, Monkey, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Purified recombinant peptide derived from within residues 95 aa to the C-terminus of mouse Rab31 produced in E. coli. |
Lenti ORF clone of Human RAB31, member RAS oncogene family (RAB31), Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
| Mammalian Cell Selection | None |
- LentiORF®
Lenti ORF clone of Human RAB31, member RAS oncogene family (RAB31), mGFP tagged
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
| Mammalian Cell Selection | None |
- LentiORF®
RAB31 HEK293T cell transient overexpression lysate (as WB positive control)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
Rabbit polyclonal anti-RAB31 antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human RAB31. |
Rabbit Polyclonal Anti-RAB31 Antibody
| Applications | WB |
| Reactivities | Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-Rab31 antibody is: synthetic peptide directed towards the middle region of Rat Rab31. Synthetic peptide located within the following region: GSAAAVIVYDITKQDSFHTLKKWVKELKEHGPENIVMAIAGNKCDLSDIR |
RAB31 / RAB22B (1-195, His-tag) human recombinant protein, 0.5 mg
| Tag | His-tag |
| Expression Host | E. coli |
RAB31 / RAB22B (1-195, His-tag) human recombinant protein, 0.1 mg
| Tag | His-tag |
| Expression Host | E. coli |
RAB31 MS Standard C13 and N15-labeled recombinant protein (NP_006859)
| Tag | C-Myc/DDK |
| Expression Host | HEK293 |
Transient overexpression of RAB31 (NM_006868) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of RAB31 (NM_006868) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of RAB31 (NM_006868) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack
Active filters
Target Symbol
- RAB31
Pathways
- Endocytosis