LCLAT1 (Myc-DDK-tagged)-Human lysocardiolipin acyltransferase 1 (LCLAT1), transcript variant 1
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
LCLAT1 (Myc-DDK-tagged)-Human lysocardiolipin acyltransferase 1 (LCLAT1), transcript variant 1
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
Lenti ORF particles, LCLAT1 (mGFP-tagged) - Human lysocardiolipin acyltransferase 1 (LCLAT1), transcript variant 1, 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP |
Tag | mGFP |
Lenti ORF particles, LCLAT1 (Myc-DDK tagged) - Human lysocardiolipin acyltransferase 1 (LCLAT1), transcript variant 1, 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK |
Tag | Myc-DDK |
LCLAT1 (GFP-tagged) - Human lysocardiolipin acyltransferase 1 (LCLAT1), transcript variant 1
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
LCLAT1 (Myc-DDK-tagged)-Human lysocardiolipin acyltransferase 1 (LCLAT1), transcript variant 2
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
Lenti-ORF clone of LCLAT1 (Myc-DDK-tagged)-Human lysocardiolipin acyltransferase 1 (LCLAT1), transcript variant 2
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, LCLAT1 (Myc-DDK-tagged)-Human lysocardiolipin acyltransferase 1 (LCLAT1), transcript variant 2, 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti-ORF clone of LCLAT1 (mGFP-tagged)-Human lysocardiolipin acyltransferase 1 (LCLAT1), transcript variant 2
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, LCLAT1 (mGFP-tagged)-Human lysocardiolipin acyltransferase 1 (LCLAT1), transcript variant 2, 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Lenti ORF clone of Human lysocardiolipin acyltransferase 1 (LCLAT1), transcript variant 1, Myc-DDK-tagged
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, LCLAT1 (Myc-DDK tagged) - Human lysocardiolipin acyltransferase 1 (LCLAT1), transcript variant 1, 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, LCLAT1 (mGFP-tagged) - Human lysocardiolipin acyltransferase 1 (LCLAT1), transcript variant 1, 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
LCLAT1 (GFP-tagged) - Human lysocardiolipin acyltransferase 1 (LCLAT1), transcript variant 2
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
Lenti ORF clone of Human lysocardiolipin acyltransferase 1 (LCLAT1), transcript variant 1, Myc-DDK-tagged
Vector | pLenti-C-Myc-DDK |
Tag | Myc-DDK |
Mammalian Cell Selection | None |
Lenti ORF clone of Human lysocardiolipin acyltransferase 1 (LCLAT1), transcript variant 1, mGFP tagged
Vector | pLenti-C-mGFP |
Tag | mGFP |
Mammalian Cell Selection | None |
Lenti ORF clone of Human lysocardiolipin acyltransferase 1 (LCLAT1), transcript variant 1, mGFP tagged
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
LCLAT1 (untagged)-Human lysocardiolipin acyltransferase 1 (LCLAT1), transcript variant 1
Vector | pCMV6-XL4 |
Tag | Tag Free |
Mammalian Cell Selection | None |
Transient overexpression lysate of lysocardiolipin acyltransferase 1 (LCLAT1), transcript variant 1
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
Rabbit Polyclonal Anti-LYCAT Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-LYCAT antibody: synthetic peptide directed towards the middle region of human LYCAT. Synthetic peptide located within the following region: YLYSLVKWYFIITIVIFVLQERIFGGLEIIELACYRLLHKQPHLNSKKNE |
LCLAT1 HEK293T cell transient overexpression lysate (as WB positive control)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
LCLAT1 (untagged)-Human lysocardiolipin acyltransferase 1 (LCLAT1), transcript variant 2
Vector | pCMV6-Entry |
Tag | Tag Free |
Mammalian Cell Selection | Neomycin |
Transient overexpression of LCLAT1 (NM_001002257) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of LCLAT1 (NM_182551) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of LCLAT1 (NM_001002257) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of LCLAT1 (NM_001002257) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack
Transient overexpression of LCLAT1 (NM_182551) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of LCLAT1 (NM_182551) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack