Products

cDNA Clones (39)
Proteins (8)
RNAi (8)
Gene Expression (7)
Antibodies (1)
Jump to Filters
View as table Download
LCLAT1 (NM_182551) Human Tagged ORF Clone
RC220664

USD 420.00

In Stock

LCLAT1 (Myc-DDK-tagged)-Human lysocardiolipin acyltransferase 1 (LCLAT1), transcript variant 1

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
Lclat1 (NM_001177968) Mouse Tagged ORF Clone
MR226119

USD 300.00

In Stock

Lclat1 (Myc-DDK-tagged) - Mouse lysocardiolipin acyltransferase 1 (Lclat1), transcript variant 3

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
LCLAT1 (NM_182551) Human Tagged ORF Clone Lentiviral Particle
RC220664L2V

USD 820.00

3 Weeks

Lenti ORF particles, LCLAT1 (mGFP-tagged) - Human lysocardiolipin acyltransferase 1 (LCLAT1), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP
Tag mGFP
  • LentiORF®
LCLAT1 (NM_182551) Human Tagged ORF Clone Lentiviral Particle
RC220664L1V

USD 820.00

3 Weeks

Lenti ORF particles, LCLAT1 (Myc-DDK tagged) - Human lysocardiolipin acyltransferase 1 (LCLAT1), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
  • LentiORF®
Lclat1 (NM_001081071) Mouse Tagged ORF Clone
MR226111

USD 300.00

In Stock

Lclat1 (Myc-DDK-tagged) - Mouse lysocardiolipin acyltransferase 1 (Lclat1), transcript variant 1

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
LCLAT1 (NM_182551) Human Tagged ORF Clone
RG220664

USD 460.00

In Stock

LCLAT1 (GFP-tagged) - Human lysocardiolipin acyltransferase 1 (LCLAT1), transcript variant 1

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
Lclat1 (NM_001177967) Mouse Tagged ORF Clone
MR226117

USD 300.00

In Stock

Lclat1 (Myc-DDK-tagged) - Mouse lysocardiolipin acyltransferase 1 (Lclat1), transcript variant 2

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
LCLAT1 (NM_001002257) Human Tagged ORF Clone
RC214304

USD 420.00

In Stock

LCLAT1 (Myc-DDK-tagged)-Human lysocardiolipin acyltransferase 1 (LCLAT1), transcript variant 2

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
LCLAT1 Human Gene Knockout Kit (CRISPR)
KN414304

USD 1,290.00

2 Weeks

LCLAT1 - KN2.0, Human gene knockout kit via CRISPR, non-homology mediated.

Format 2 gRNA vectors, 1 linear donor
Donor DNA EF1a-GFP-P2A-Puro
KN414304 is the updated version of KN214304.
Lclat1 Mouse Gene Knockout Kit (CRISPR)
KN509177

USD 1,290.00

2 Weeks

Lclat1 - KN2.0, Mouse gene knockout kit via CRISPR, non-homology mediated.

Format 2 gRNA vectors, 1 linear donor
Donor DNA EF1a-GFP-P2A-Puro
KN509177 is the updated version of KN309177.
Lclat1 (NM_001081071) Mouse Tagged ORF Clone
MG226111

USD 330.00

3 Weeks

Lclat1 (GFP-tagged) - Mouse lysocardiolipin acyltransferase 1 (Lclat1) transcript variant 1, (10ug)

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
Lclat1 (NM_001177967) Mouse Tagged ORF Clone
MG226117

USD 330.00

3 Weeks

Lclat1 (GFP-tagged) - Mouse lysocardiolipin acyltransferase 1 (Lclat1) transcript variant 2, (10ug)

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
Lclat1 (NM_001177968) Mouse Tagged ORF Clone
MG226119

USD 330.00

3 Weeks

Lclat1 (GFP-tagged) - Mouse lysocardiolipin acyltransferase 1 (Lclat1) transcript variant 3, (10ug)

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
Lclat1 (NM_001081071) Mouse Tagged ORF Clone
MR226111L3

USD 500.00

3 Weeks

Lenti ORF clone of Lclat1 (Myc-DDK-tagged) - Mouse lysocardiolipin acyltransferase 1 (Lclat1), transcript variant 1

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Lclat1 (NM_001081071) Mouse Tagged ORF Clone Lentiviral Particle
MR226111L3V

USD 700.00

6 Weeks

Lenti ORF particles, Lclat1 (Myc-DDK-tagged) - Mouse lysocardiolipin acyltransferase 1 (Lclat1), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Lclat1 (NM_001081071) Mouse Tagged ORF Clone
MR226111L4

USD 500.00

3 Weeks

Lenti ORF clone of Lclat1 (mGFP-tagged) - Mouse lysocardiolipin acyltransferase 1 (Lclat1), transcript variant 1

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
Lclat1 (NM_001081071) Mouse Tagged ORF Clone Lentiviral Particle
MR226111L4V

USD 700.00

6 Weeks

Lenti ORF particles, Lclat1 (GFP-tagged) - Mouse lysocardiolipin acyltransferase 1 (Lclat1), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
Lclat1 (NM_001177967) Mouse Tagged ORF Clone
MR226117L3

USD 500.00

3 Weeks

Lenti ORF clone of Lclat1 (Myc-DDK-tagged) - Mouse lysocardiolipin acyltransferase 1 (Lclat1), transcript variant 2

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Lclat1 (NM_001177967) Mouse Tagged ORF Clone Lentiviral Particle
MR226117L3V

USD 700.00

6 Weeks

Lenti ORF particles, Lclat1 (Myc-DDK-tagged) - Mouse lysocardiolipin acyltransferase 1 (Lclat1), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Lclat1 (NM_001177967) Mouse Tagged ORF Clone
MR226117L4

USD 500.00

3 Weeks

Lenti ORF clone of Lclat1 (mGFP-tagged) - Mouse lysocardiolipin acyltransferase 1 (Lclat1), transcript variant 2

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
Lclat1 (NM_001177967) Mouse Tagged ORF Clone Lentiviral Particle
MR226117L4V

USD 700.00

6 Weeks

Lenti ORF particles, Lclat1 (GFP-tagged) - Mouse lysocardiolipin acyltransferase 1 (Lclat1), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
Lclat1 (NM_001177968) Mouse Tagged ORF Clone
MR226119L3

USD 500.00

3 Weeks

Lenti ORF clone of Lclat1 (Myc-DDK-tagged) - Mouse lysocardiolipin acyltransferase 1 (Lclat1), transcript variant 3

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Lclat1 (NM_001177968) Mouse Tagged ORF Clone Lentiviral Particle
MR226119L3V

USD 700.00

6 Weeks

Lenti ORF particles, Lclat1 (Myc-DDK-tagged) - Mouse lysocardiolipin acyltransferase 1 (Lclat1), transcript variant 3, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Lclat1 (NM_001177968) Mouse Tagged ORF Clone
MR226119L4

USD 500.00

3 Weeks

Lenti ORF clone of Lclat1 (mGFP-tagged) - Mouse lysocardiolipin acyltransferase 1 (Lclat1), transcript variant 3

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
Lclat1 (NM_001177968) Mouse Tagged ORF Clone Lentiviral Particle
MR226119L4V

USD 700.00

6 Weeks

Lenti ORF particles, Lclat1 (GFP-tagged) - Mouse lysocardiolipin acyltransferase 1 (Lclat1), transcript variant 3, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
LCLAT1 (NM_001002257) Human Tagged ORF Clone
RC214304L3

USD 620.00

3 Weeks

Lenti-ORF clone of LCLAT1 (Myc-DDK-tagged)-Human lysocardiolipin acyltransferase 1 (LCLAT1), transcript variant 2

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
LCLAT1 (NM_001002257) Human Tagged ORF Clone Lentiviral Particle
RC214304L3V

USD 820.00

6 Weeks

Lenti ORF particles, LCLAT1 (Myc-DDK-tagged)-Human lysocardiolipin acyltransferase 1 (LCLAT1), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
LCLAT1 (NM_001002257) Human Tagged ORF Clone
RC214304L4

USD 620.00

3 Weeks

Lenti-ORF clone of LCLAT1 (mGFP-tagged)-Human lysocardiolipin acyltransferase 1 (LCLAT1), transcript variant 2

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
LCLAT1 (NM_001002257) Human Tagged ORF Clone Lentiviral Particle
RC214304L4V

USD 820.00

6 Weeks

Lenti ORF particles, LCLAT1 (mGFP-tagged)-Human lysocardiolipin acyltransferase 1 (LCLAT1), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
LCLAT1 (NM_182551) Human Tagged ORF Clone
RC220664L3

USD 620.00

3 Weeks

Lenti ORF clone of Human lysocardiolipin acyltransferase 1 (LCLAT1), transcript variant 1, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
LCLAT1 (NM_182551) Human Tagged ORF Clone Lentiviral Particle
RC220664L3V

USD 820.00

5 Weeks

Lenti ORF particles, LCLAT1 (Myc-DDK tagged) - Human lysocardiolipin acyltransferase 1 (LCLAT1), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
LCLAT1 (NM_182551) Human Tagged ORF Clone Lentiviral Particle
RC220664L4V

USD 820.00

7 Weeks

Lenti ORF particles, LCLAT1 (mGFP-tagged) - Human lysocardiolipin acyltransferase 1 (LCLAT1), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
LCLAT1 (NM_001002257) Human Tagged ORF Clone
RG214304

USD 460.00

3 Weeks

LCLAT1 (GFP-tagged) - Human lysocardiolipin acyltransferase 1 (LCLAT1), transcript variant 2

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
LCLAT1 (NM_182551) Human Tagged Lenti ORF Clone
RC220664L1

USD 768.00

In Stock

Lenti ORF clone of Human lysocardiolipin acyltransferase 1 (LCLAT1), transcript variant 1, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
Mammalian Cell Selection None
  • LentiORF®
LCLAT1 (NM_182551) Human Tagged Lenti ORF Clone
RC220664L2

USD 768.00

In Stock

Lenti ORF clone of Human lysocardiolipin acyltransferase 1 (LCLAT1), transcript variant 1, mGFP tagged

Vector pLenti-C-mGFP
Tag mGFP
Mammalian Cell Selection None
  • LentiORF®
LCLAT1 (NM_182551) Human Tagged ORF Clone
RC220664L4

USD 768.00

In Stock

Lenti ORF clone of Human lysocardiolipin acyltransferase 1 (LCLAT1), transcript variant 1, mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
LCLAT1 (NM_182551) Human Untagged Clone
SC107411

USD 700.00

In Stock

LCLAT1 (untagged)-Human lysocardiolipin acyltransferase 1 (LCLAT1), transcript variant 1

Vector pCMV6-XL4
Tag Tag Free
Mammalian Cell Selection None
LCLAT1 (NM_182551) Human Over-expression Lysate
LY405476

USD 396.00

In Stock

Transient overexpression lysate of lysocardiolipin acyltransferase 1 (LCLAT1), transcript variant 1

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
LCLAT1 Human shRNA Plasmid Kit (Locus ID 253558)
TL311637

USD 815.00

In Stock

LCLAT1 - Human, 4 unique 29mer shRNA constructs in lentiviral GFP vector

Format Lentiviral plasmids
Vector pGFP-C-shLenti
LCLAT1 Human siRNA Oligo Duplex (Locus ID 253558)
SR326063

USD 430.00

In Stock

LCLAT1 (Human) - 3 unique 27mer siRNA duplexes - 2 nmol each

Purity HPLC purified
Number of Transfections Approximately 330 transfections/2nmol in 24-well plate under optimized conditions (final conc. 10 nM).

Special offer: Get $100/€100 off this product. Use code: SR100

SR326063 is the updated version of SR316749.
LCLAT1 Rabbit Polyclonal Antibody
TA335289

USD 375.00

5 Days

Rabbit Polyclonal Anti-LYCAT Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-LYCAT antibody: synthetic peptide directed towards the middle region of human LYCAT. Synthetic peptide located within the following region: YLYSLVKWYFIITIVIFVLQERIFGGLEIIELACYRLLHKQPHLNSKKNE
LCLAT1 (NM_182551) Human Over-expression Lysate
LC405476

USD 121.00

In Stock

LCLAT1 HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
LCLAT1 Human qPCR Template Standard (NM_182551)
HK212339

USD 440.00

5 Days

qPCR primer pairs and template standards against Homo sapiens gene LCLAT1

Application Plasmid of exact quantity for transcript copy number calculation
Human LCLAT1 activation kit by CRISPRa
GA116747

USD 1,290.00

2 Weeks

LCLAT1 CRISPRa kit - CRISPR gene activation of human lysocardiolipin acyltransferase 1

Format 3gRNAs, 1 scramble ctrl and 1 enhancer vector
Mouse Lclat1 activation kit by CRISPRa
GA213747

USD 1,290.00

2 Weeks

Lclat1 CRISPRa kit - CRISPR gene activation of mouse lysocardiolipin acyltransferase 1

Format 3gRNAs, 1 scramble ctrl and 1 enhancer vector
LCLAT1 Human qPCR Primer Pair (NM_182551)
HP225392

USD 120.00

5 Days

qSTAR qPCR primer pairs against Homo sapiens gene LCLAT1

Lclat1 (NM_001081071) Mouse Untagged Clone
MC212743

USD 420.00

3 Weeks

Lclat1 (untagged) - Mouse lysocardiolipin acyltransferase 1 (Lclat1), transcript variant 1, (10ug)

Vector pCMV6-Entry
Tag Tag Free
Mammalian Cell Selection Neomycin
Lclat1 (NM_001177968) Mouse Untagged Clone
MC212744

USD 420.00

3 Weeks

Lclat1 (untagged) - Mouse lysocardiolipin acyltransferase 1 (Lclat1), transcript variant 3, (10ug)

Vector pCMV6-Entry
Tag Tag Free
Mammalian Cell Selection Neomycin
Lclat1 (NM_001177967) Mouse Untagged Clone
MC212745

USD 420.00

3 Weeks

Lclat1 (untagged) - Mouse lysocardiolipin acyltransferase 1 (Lclat1), transcript variant 2, (10ug)

Vector pCMV6-Entry
Tag Tag Free
Mammalian Cell Selection Neomycin
Lclat1 Mouse qPCR Primer Pair (NM_001081071)
MP207686

USD 120.00

5 Days

qSTAR qPCR primer pairs against Mus musculus gene Lclat1